Company Name: |
GL Biochem (Shanghai) Ltd
|
Tel: |
21-61263452 13641803416 |
Email: |
ymbetter@glbiochem.com |
Products Intro: |
Product Name:b-Endorphin: 1-5 +: 16-31, human Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
Company Name: |
Nanjing Peptide Biotech Ltd.
|
Tel: |
025-025-58361106-805-805 13082558573 |
Email: |
liugang@njpeptide.com |
Products Intro: |
Product Name:b-Endorphin: 1-5 +: 16-31, human Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
|
|
| b-Endorphin: 1-5 +: 16-31, human Basic information |
Product Name: | b-Endorphin: 1-5 +: 16-31, human | Synonyms: | b-Endorphin: 1-5 +: 16-31, human;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-VAL-LYS-ASN-ALA-HIS-LYS-LYS-GLY-GLN: YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ | CAS: | | MF: | | MW: | 0 | EINECS: | | Product Categories: | | Mol File: | Mol File | ![b-Endorphin: 1-5 +: 16-31, human Structure]() |
| b-Endorphin: 1-5 +: 16-31, human Chemical Properties |
| b-Endorphin: 1-5 +: 16-31, human Usage And Synthesis |
| b-Endorphin: 1-5 +: 16-31, human Preparation Products And Raw materials |
|