|
|
| | (GLN11)-AMYLOID BETA-PROTEIN (1-28) Basic information |
| Product Name: | (GLN11)-AMYLOID BETA-PROTEIN (1-28) | | Synonyms: | BETA-AMYLOID PEPTIDE (1-40, GLN11), HUMAN;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLN-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-OH;(GLN11)-AMYLOID BETA-PROTEIN (1-28);[GLN11]-BETA-AMYLOID (1-28);[GLN11]-BETA-AMYLOID (1-40);DAEFRHDSGYQVHHQKLVFFAEDVGSNK;DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV;(gln11)-amyloid B-protein fragment 1-28 | | CAS: | 106686-61-7 | | MF: | C145H210N42O45 | | MW: | 3261.47 | | EINECS: | | | Product Categories: | peptide | | Mol File: | 106686-61-7.mol |  |
| | (GLN11)-AMYLOID BETA-PROTEIN (1-28) Chemical Properties |
| density | 1.52±0.1 g/cm3(Predicted) | | storage temp. | -15°C | | form | Solid | | Water Solubility | Soluble in water at 1mg/ml |
| | (GLN11)-AMYLOID BETA-PROTEIN (1-28) Usage And Synthesis |
| Uses | [Gln11] Amyloid beta (1-28) Aβ(s) peptides, their peptide fragments and mutated fragments are used to study a wide range of metabolic and regulatory functions including activation of kinases, regulation of cholesterol transport, function as a transcription factor, and regulators of inflammation. Aβ(s) peptides and their peptide fragments are also used to study oxidative stress, metal binding and mechanisms of protein cross-linking in the context of diseases such as Alzheimer?s disease and neurodegeneration. |
| | (GLN11)-AMYLOID BETA-PROTEIN (1-28) Preparation Products And Raw materials |
|