Welcome to chemicalbook!
400-158-6606

Get started now

or
My Account
Buyers
Inquiry management
Suppliers
Quotation management
Request for quotation
My ChemicalBook
My ChemicalBook
Postion:Product Catalog >Biochemical Engineering>Polypeptide>H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2

US $7.00 / 1KG

Min. Order: 1KG
Purity: 99%
Cas No.: 127317-03-7
Supply Ability: 100kg
  • 1KG

Overview

Product Name: H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
CAS No.: 127317-03-7
EC-No.:
Min. Order: 1KG
Purity: 99%
Supply Ability: 100kg
Release date: 2020/02/14
Name: Judy Liang
Product Advantage
Product Name: H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
Synonyms: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2;HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2;H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2;[ARG14,20,21, LEU16] PACAP (1-27), HUMAN, OVINE, RAT;[ARG14,20,21, LEU16] PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-27), HUMAN, OVINE, RAT;ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-27 OVINE;ADENYLATE CYCLASE ACTIVATING PEPTIDE-27;pituitary adenylate cyclase activating*polypeptid
CAS: 127317-03-7
MF: C142H224N40O39S
MW: 3147.61
EINECS:
Product Categories: Peptide;VIP and PACAP receptor
Mol File: 127317-03-7.mol
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Structure
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Chemical Properties
density 1.45±0.1 g/cm3(Predicted)
storage temp. −20°C
form solid
color white
Safety Information
WGK Germany 3

Country:China

Business model: Trader,Manufacturer

CB index: 58

Audit supplier

  • Telephone: 0086-371-86658258
  • Fax: 0086-371-86658258
  • Mobile: 13203830695
  • Address: Room 702, Floor 7, Building 10, National University Science Park, High-Tech Zone

You may like

3-phenylcyclobutan-1-amine

3-phenylcyclobutan-1-amine

CAS:90874-41-2

USD $ 1.00 / 1g

Glyceroltriglycidylether

Glyceroltriglycidylether

CAS:13236-02-7

USD $ 1.00 / 1g

Butyldi-1-adamantylphosphine

Butyldi-1-adamantylphosphine

CAS:321921-71-5

USD $ 1.00 / 1g

Diphenylmethyl7beta-Tert-Butoxycarbonylamino-3-Chloromethyl-3-Cephem-4-Carboxylate
1,2-Dimethylpropylamine

1,2-Dimethylpropylamine

CAS:598-74-3

USD $ 1.00 / 1g