BOC Sciences

BOC Sciences

Business Bank account
Business Address
Basic Contact Infomation
Manufacturer
Current Location: HOME >> Product
Product Categories
BOC Sciences
Country: United States
Tel: 16314854226
Mobile: +16314854226
E-mail: inquiry@bocsci.com
QQ:
Skype: Chat Now!
Product Name MF CAS Details
C-Jun-amino-terminal kinase-interacting protein 2 (683-692) Details
Chlorotoxin (linear) C???H???N??O??S?? Details
Coiled-coil and C2 domain-containing protein 2A isoform a (1275-1287) Details
Cleavage and polyadenylation specificity factor subunit 1 (250-258) Details
Chondroitin sulfate proteoglycan 4 (693-708) Details
CHMP7 protein, partial (48-62) Details
Cleavage and polyadenylation specificity factor subunit 1 (1360-1369) Details
Chondrosarcoma-associated gene 2/3 protein (34-48) Details
CLIP 86-100 C72H128N20O19S3 648881-58-7 Details
CLPP (240-248) Details
Chondromodulin-I (319-327) Details
CGEHSDYKHY Details
Cellular tumor antigen p53 (99-107) Details
CDK4-R24C (23-32) Details
Cellular tumor antigen p53 (193-204) Details
CD20 (188-196) Details
CD59 glycoprotein precursor (106-114) Details
Cellular tumor antigen p53 (217-225) Details
CGI-55 protein (21-31) Details
Centrosome-associated protein 350 (2297-2305) Details
cell division cycle 45-like (556-564) Details
Cell division cycle protein 27 homolog (760-771) Details
Centriolin (2174-2182) Details
Cellular tumor antigen p53 (153-165) Details
Cullin-7 (1271-1279) Details
Cyclo(-L-Ala-L-Ile) C9H16N2O2 35590-69-3 Details
Cyclin-A1 (385-395) Details
CTNNB1 (29-37) Details
Crebtide C73H129N29O19 149155-45-3 Details
Cys-TAT (47-57) C67H124N34O14S 583836-55-9 Details
D-dopachrome decarboxylase (89-97) Details
Cysteine-rich protein 2 isoform 2 (133-147) Details
DNA repair protein RAD50 (1281-1289) Details
Ephrin type-A receptor 3 (356-367) Details
DNA-dependent protein kinase catalytic subunit (2836-2844) Details
D-Ala-L-Leu-D-Asp-L-Arg-Phe-D-Glu (iso)-D-Ala, cyclic form Details
EFSLVVVRYPQYGVG Details
EELVDYKSCAHDWVY Details
D-Lys(Z)-Pro-Arg-pNA C31H43N9O7 108963-69-5 Details
Eptifibatide Impurity 2 Details
DEAD (Asp-Glu-Ala-Asp) box polypeptide 53 (502-513) Details
EEF2 (581-589) Details
D-Ala-L-Leu-D-Asp-L-Arg-Phe-D-Glu (iso)-D-Ala Details
Death-inducer obliterator 1 (941-951) Details
Eptifibatide Impurity 1 Details
dek-can fusion protein (342-357) Details
Cytochrome p450 1B1 (239-248) Details
EAVRLFIEWLKNGGPSSGAPPPS C???H???N??O?? Details
DNA ligase 3 isoform alpha precursor (790-806) Details
EFTUD2 (668-677) Details
Epidermal growth factor receptor (478-488) Details
EDDR1 (867-876) Details
D-Lys(Z)-Pro-Arg-pNA diacetate C35H51N9O11 108963-70-8 Details
DRIM protein (299-307) Details
E3 ubiquitin-protein ligase RNF43 (721-729) Details
E3 ubiquitin-protein ligase RNF43 (11-19(20)) Details
EGF-R (1138-1147) Details
D-γ-Glutamyl-D-glutamic acid C10H16N2O7 4553-17-7 Details
DAPK2 protein (1-9) Details
E3 ubiquitin-protein ligase UBR4 (329-337) Details
Epithelial cell adhesion molecule (173-181) Details
Dickkopf-related protein 1 (20-29) Details
DNA-binding protein RFX6 (414-431) Details
Eph-like receptor tyrosine kinase hEphB1b (422-432) Details
Eptifibatide Impurity 3 Details
Cullin-7 (915-923) Details
Coiled-coil domain-containing protein 110 (499-508) Details
Cyclo(Arg-Pro) C11H19N5O2 Details
Coiled-coil domain-containing protein 110 (770-778) Details
Cyclin-A1 (271-279) Details
Cyclin-dependent kinase 4 (924-932) Details
Coiled-coil domain-containing protein 110 (196-204) Details
E3 ubiquitin-protein ligase Mdm2 (53-60) Details
Cyclosporin A-Derivative 2 C58H104N10O13 156047-45-9 Details
FITC-L-methionine Details
FN1 (2050-2063) Details
Fibronectin type III domain-containing protein 3B (292-300) Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Details
G1/S-specific cyclin-D1 (198-212) Details
Fmoc-Glu(AspG3)-OH C80H118N8O27 1858229-70-5 Details
G3-C12 C74H115N23O23S2 848301-94-0 Details
G1/S-specific cyclin-D1 (101-109) Details
FITC-Ahx-Arg-Gly-Asp Details
Fructose-bisphosphate aldolase A isoform 2 (207-222) Details
FliC, Serotype a (427-441), S.paratyphi A C69H113N23O24 857678-38-7 Details
Fructose-bisphosphate aldolase A isoform 2 (326-338) Details
Eukaryotic initiation factor 4A-III (110-119) Details
ER membrane protein complex subunit 1 isoform 3 precursor (640-648) Details
Exendin derivative 1 C???H???N??O??S Details
F-box protein FBL5 (227-255) Details
Ewing Tumor EZH2 (666-674) Details
ETV6-AML1 fusion protein (334-342) Details
ERBB2IP protein (1003-1018) Details
Eukaryotic translation initiation factor 4 gamma 1 (1248-1256) Details
Eukaryotic translation elongation factor 1 alpha 1 (115-129) Details
FAST kinase domain-containing protein 1 isoform 1 (497-514) Details
Fanconi anemia group M protein (201-214) Details
FBXO41 protein, partial (284-297) Details
ETV6-AML1 fusion protein (332-346) Details
Eukaryotic translation initiation factor 4 gamma 1 (719-727) Details
Product Total: Product Page:
125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197