Product Categories
| Country: | China |
|---|---|
| Tel: | 21-61263452 |
| Mobile: | 13641803416 |
| E-mail: | |
| QQ: | |
| Skype: | Chat Now! |
| Company Name: | Shanghai GL Peptide Ltd |
| Tel: | 86-21-61263385 |
| Fax: | 86-21-61263399 |
| Email: | ymbetter@glbiochem |
| WebSite: | http://www.glbiochem.com |
| Nationality: | CHINA |
| Product Name | MF | CAS | Details |
|---|
| Neuropeptide SF (human) | C65H94N18O15 | 192387-39-6 | Details |
| Neurotensin (Frog) | C70H115N23O17 | Details |
| Nesfatin-1 (mouse) | 917528-36-0 | Details |
| Neurokinins, Neuromedins, Other Tachykinins and Related Peptides | Details |
| Neuropeptide Y, human, rat, [D-Trp32]- | Details |
| Neuropeptide Y, porcine, [Pro34]- | Details |
| Neuropeptide Y (2-36), porcine;PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 | 102961-52-4 | Details |
| N-2-Chloroethyl-Val-Leu-anilide | C19H30ClN3O2 | 282729-48-0 | Details |
| N1-Glutathionyl-spermidine disulfide | C34H66N12O10S2 | 108081-77-2 | Details |
| N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide | C21H35N3O5 | 1926163-76-9 | Details |
| Neuropeptide W-30 (human) | C165H249N49O37S | 383415-80-3 | Details |
| N-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide | C20H33N3O3 | 282726-24-3 | Details |
| N-cis-2,6-Dimethylpiperidinocarbonyl-β-tBu-Ala-D-Trp(1-methoxycarbonyl)-D-Nle-OH | Details |
| Neuropeptide FF-amide | Details |
| Neuropeptide Y (human, rat) Acetate 200 μg/vial (Clinalfa basic) | Details |
| N-2-Hydroxyethyl-Val-Leu-anilide | C19H31N3O3 | 194351-53-6 | Details |
| Neuromedin (U-25), porcine;FKVDEEFQGPIVSQNRRYFLFRPRN-NH2 | C144H217N43O37 | 98395-76-7 | Details |
| N-2-Cyanoethyl-Val-Leu-anilide | C20H30N4O2 | 194351-52-5 | Details |
| Nazumamide A | C28H43N7O8 | 138949-86-7 | Details |
| Neuronostatin-19 (mouse, rat) | Details |
| Neuropeptide Y (13-36), porcine, [Leu31,Pro34]- | Details |
| Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH | C60H105N17O12 | 147217-25-2 | Details |
| N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide | C25H35N3O3 | 282732-35-8 | Details |
| Neuropeptide F;PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 | 136697-70-6 | Details |
| Neurotensin (1-8) | C46H71N13O14 | 80887-44-1 | Details |
| Neurokinin Receptor (393-407), rat;KTMTESSFYSNMLA | C69H108N16O24S2 | Details |
| Nectofibrin Hexapeptide (rat) | C32H47N7O9 | 123402-49-3 | Details |
| N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH | Details |
| Neuropeptide Y (3-36), human, rat;SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | C175H269N53O54S1 | 150138-78-6 | Details |
| N-[(RS)-2-Carbamoyl-2-hydroxy-ethyl]-Val-Leu-anilide | C20H32N4O4 | 1926163-77-0 | Details |
| Neuropeptide W-23 (human) | C119H183N35O28S | 383415-79-0 | Details |
| Neuropeptide W-23 (rat) | C119H183N35O29S | 383415-89-2 | Details |
| Nesfatin-1 (rat) | 917528-37-1 | Details |
| Neuronostatin-13 (human, canine, porcine) | Details |
| Neuropeptide Y, human, rat, [Leu31,Pro34]- | Details |
| Neuropeptide Y, porcine, Biotinyl- | Details |
| N,S-Bis-Fmoc-glutathione | C40H37N3O10S | 149438-56-2 | Details |
| Neurokinin A: Substance K: Neuromedin L: NKA;HKTDSFVGLM-NH2 | C50H80N14O14S | 86933-74-6 | Details |
| Nephilatoxin NPTX-11 | C24H37N7O4 | 119613-54-6 | Details |
| Neuropeptide FF Morphine Modulating Neuropeptide F-8-F-NH2 | C54H76N14O10 | 99566-27-5 | Details |
| Neuropeptide S, NPS, human;SFRNGVGTGMKKTSFQRAKS | C93H155N31O28S | 412938-67-1 | Details |
| N(p-Tosyl)-GPR-pNA | C26H34N8O7S | Details |
| Neoendorphin (1-5), α- | Details |
| Neuropeptide Y (13-36), human, rat, [Leu31,Pro34]- | Details |
| Neuropeptide Y (NPY) and Related Peptides | Details |
| Ne-Trifluoroacetyl-L-lysine | C8H13F3N2O3 | 10009-20-8 | Details |
| Neuromedin U, rat;YKVNEYQGPVAPSGGFFLFRPRN-NH2 | C124H180N34O31 | 117505-80-3 | Details |
| Neurotensin;Pyr-LYENKPRRPYIL | C78H121N21O20 | 55508-42-4 | Details |
| Neo-Kyotorphin | C28H47N9O9 | 83759-54-0 | Details |
| Neuromedin S, human??;ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2 | 1138204-27-9 | Details |
| Myristoylated Protein Kinase C (19-31) | Details |
| Neuropeptide AF | Details |
| Neuropeptide Y (27-36), [D-Tyr27&36,D-Thr32]- | Details |
| Neuropeptide Y, porcine;YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 | C190H287N55O57 | 82785-45-3 | Details |
| N-(2-Carbamoyl-ethyl)-Val-Leu-anilide | C20H32N4O3 | 282725-67-1 | Details |
| Neuropeptide S (1-10) (human) | C42H68N14O14S | 904910-39-0 | Details |
| Neuropeptide Y(18-36), porcine;ARYYSALRHYINLITRQRY-NH2 | C109H169N35O26 | 98264-90-5 | Details |
| Neuroendocrine Regulatory Peptide-1 (rat) | C110H180N32O38 | 954420-51-0 | Details |
| Neuroendocrine Regulatory Peptide-2 (human) | Details |
| Neuronostatin-13 (mouse, rat) | Details |
| Neuropeptide Y, human, rat, Biotinyl- | Details |
| Neuropeptide Y, porcine, Free Acid | Details |
| Neuropeptide VF (124-131) (human) | C45H72N14O10 | 311309-27-0 | Details |
| Nesfatin-1 (human) | 917528-35-9 | Details |
| Neurokinin A (4-10), [?-Ala8]- | Details |
| Neuropeptide Y, human, Free Acid | Details |
| Neuropeptide Y, porcine, [Leu31,Pro34]- | Details |
| N-Et-Val-Leu-anilide | C19H31N3O2 | 282726-22-1 | Details |
| Neuropeptide S, NPS, rat;SFRNGVGSGVKKTSFRRAKQ | C95H160N34O27 | 412938-75-1 | Details |
| Myristoyl-Lys-Arg-Thr-Leu-Arg-OH | C42H82N12O8 | 125678-68-4 | Details |
| Neuropeptide VF (56-92) (human) | 381006-66-2 | Details |
| Neuropeptide Y (13-36), human, rat;PAEDMARYYSALRHYINLITRQRY-NH2 | C134H207N41O36S | 122341-40-6 | Details |
| Nephilatoxin NPTX-9 | C30H49N11O5 | 114355-42-9 | Details |
| Neuromedin U-23 (rat) | Details |
| N-(Cyanur-2-yl)-Asp-Ala-anilide | Details |
| Neuropeptide FF Morphine Modulating Neuropeptide | Details |
| Neuropeptide Y (free acid) (human) | Details |
| Neuropeptide Y (3-36), porcine;SKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 | C176H271N53O54 | 143863-88-1 | Details |
| Neuropeptide GE | C81H125N23O34 | 134748-04-2 | Details |
| Neuropeptide Y (1-24) amide, human, rat;YPSKPDNPGEDAPAEDMARYYSAL-NH2 | C116H170N30O40S | 131448-51-6 | Details |
| Neuromedin N;KIPYIL-NH2 | C38H63N7O8 | 92169-45-4 | Details |
| Neuromedin (U-8), porcine;YFLFRPRN-NH2 | C54H78N16O10 | 98395-75-6 | Details |
| N-2-Ethoxyethyl-Val-Ala-anilide | C18H29N3O3 | 194351-51-4 | Details |
| Neuropeptide Y (22-36), porcine;SALRHYINLITRQRY-NH2 | C85H139N29O21 | 119019-65-7 | Details |
| N-((RS)-2-Hydroxy-1-phenyl-ethyl)-Val-Leu-anilide | C25H35N3O3 | 283159-27-3 | Details |
| Neuropeptide Y, human, rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | C189H285N55O57S | 99575-89-0 | Details |
| Myristoylated ADP - Ribosylation Factor 6, myr - ARF6 (2 - 13) | Details |
| Neuropeptide SF | Details |
| N-((RS)-3-Chloro-2-hydroxy-propyl)-Val-Leu-anilide | C20H32ClN3O3 | 282726-25-4 | Details |
| Neuroendocrine Regulatory Peptide-1 (human) | C113H192N36O39 | 954420-50-9 | Details |
| Neuroendocrine Regulatory Peptide-2 (rat) | Details |
| Neuronostatin-19 (human, canine, porcine) | C90H151N29O25 | 1872435-06-7 | Details |
| Neuropeptide Y, porcine, [D-Trp32]- | Details |
| Neuropeptide γ | Details |
| Neuropeptide W-30 (rat) | C165H249N49O38S | 383415-90-5 | Details |
| Neuropeptide Y(13-36), porcine;PAEDLARYYSALRHYINLITRQRY-NH2 | C135H209N41O36 | 113662-54-7 | Details |
| Neuropeptide Y (2-36), human, rat;PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | 123139-39-9 | Details |
| Neuropeptide AF (human) | C90H132N26O25 | 192387-38-5 | Details |
| N-2-Aminoethyl-Val-Leu-anilide | C19H32N4O2 | 282732-36-9 | Details |
| Neuromedin S (rat) | C193H307N57O49S | 843782-19-4 | Details |
| Product Total： Product Page： | ||||
| 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 | ||||