Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> CHARYBDOTOXIN

CHARYBDOTOXIN

CHARYBDOTOXIN price.
  • $163 - $9193.6
  • Product name: CHARYBDOTOXIN
  • CAS: 95751-30-7
  • MF: C176H277N57O55S7
  • MW: 4295.89
  • EINECS:
  • MDL Number:MFCD00146378
  • Synonyms:CHARYBDOTOXIN;CHARYBDOTOXIN, RECOMBINANT;CHARYBDOTOXIN, RECOMBINANT, E COLI;CHARYBDOTOXIN, LEIURUS QUINQUESTRIATUS HEBRAEUS;CHTX;PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS;PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (DISULFIDE BRIDGE: 7-28,13-33 AND 17-35);PYR-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLN-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER-OH
12 prices
Selected condition:
Brand
  • ApexBio Technology
  • Biorbyt Ltd
  • Biosynth Carbosynth
  • Sigma-Aldrich
  • TRC
  • Usbiological
Package
  • 10ug
  • 50ug
  • 0.1mg
  • 100ug
  • 250ug
  • 250μg
  • 500ug
  • 1mg
  • 5mg
  • 10mg
  • ManufacturerApexBio Technology
  • Product numberB6592
  • Product descriptionCharybdotoxin
  • Packaging10ug
  • Price$282
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372971
  • Product descriptionCharybdotoxin > 95%
  • Packaging10mg
  • Price$9193.6
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372971
  • Product descriptionCharybdotoxin > 95%
  • Packaging5mg
  • Price$6131.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372971
  • Product descriptionCharybdotoxin > 95%
  • Packaging1mg
  • Price$2459.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC110443
  • Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
  • Packaging50ug
  • Price$163
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC110443
  • Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
  • Packaging100ug
  • Price$283
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC110443
  • Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
  • Packaging250ug
  • Price$565
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC110443
  • Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
  • Packaging500ug
  • Price$985
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC110443
  • Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
  • Packaging1mg
  • Price$1710
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberC7802
  • Product descriptionCharybdotoxin ≥90% (HPLC)
  • Packaging0.1mg
  • Price$592.8
  • Updated2025-07-31
  • Buy
  • ManufacturerTRC
  • Product numberC291853
  • Product descriptionCharybdotoxin
  • Packaging250μg
  • Price$530
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC3801
  • Product descriptionCharybdotoxin
  • Packaging5mg
  • Price$665
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
ApexBio Technology B6592 Charybdotoxin 10ug $282 2021-12-16 Buy
Biorbyt Ltd orb372971 Charybdotoxin > 95% 10mg $9193.6 2021-12-16 Buy
Biorbyt Ltd orb372971 Charybdotoxin > 95% 5mg $6131.9 2021-12-16 Buy
Biorbyt Ltd orb372971 Charybdotoxin > 95% 1mg $2459.9 2021-12-16 Buy
Biosynth Carbosynth FC110443 Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) 50ug $163 2021-12-16 Buy
Biosynth Carbosynth FC110443 Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) 100ug $283 2021-12-16 Buy
Biosynth Carbosynth FC110443 Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) 250ug $565 2021-12-16 Buy
Biosynth Carbosynth FC110443 Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) 500ug $985 2021-12-16 Buy
Biosynth Carbosynth FC110443 Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) 1mg $1710 2021-12-16 Buy
Sigma-Aldrich C7802 Charybdotoxin ≥90% (HPLC) 0.1mg $592.8 2025-07-31 Buy
TRC C291853 Charybdotoxin 250μg $530 2021-12-16 Buy
Usbiological C3801 Charybdotoxin 5mg $665 2021-12-16 Buy

Properties

RTECS :FL7535000
storage temp. :-20°C
form :lyophilized powder
Water Solubility :Soluble to 1 mg/ml in water
Sequence :{Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
InChIKey :CNVQLPPZGABUCM-LIGYZCPXSA-N

Safety Information

Symbol(GHS): GHS hazard pictograms
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning GHS hazard pictograms P264, P270, P301+P312, P330, P501
H312 Harmful in contact with skin Acute toxicity,dermal Category 4 Warning GHS hazard pictograms P280,P302+P352, P312, P322, P363,P501
H332 Harmful if inhaled Acute toxicity,inhalation Category 4 Warning GHS hazard pictograms P261, P271, P304+P340, P312
Precautionary statements:
P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P264 Wash hands thoroughly after handling.
P264 Wash skin thouroughly after handling.
P270 Do not eat, drink or smoke when using this product.
P271 Use only outdoors or in a well-ventilated area.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P301+P312 IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell.
P302+P352 IF ON SKIN: wash with plenty of soap and water.
P304+P340 IF INHALED: Remove victim to fresh air and Keep at rest in a position comfortable for breathing.
P312 Call a POISON CENTER or doctor/physician if you feel unwell.
P322 Specific measures (see …on this label).
P330 Rinse mouth.
P363 Wash contaminated clothing before reuse.
P501 Dispose of contents/container to..…

Description

Charybdotoxin is a peptide found in the venom of the scorpion Leiurus quinquestriatus. MaxiK (High, BK) or IK1 (intermediate) conductance calcium-activated and Kv1.3 (voltage-gated channel) inhibitor. A potent and selective blocker of the large conductance Ca2+-activated K+, Slo channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Present in GH3 anterior pituitary cells and primary bovine aortic smooth muscle cells.

Related product price