Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> Calcitonin

Calcitonin

Calcitonin price.
  • $403 - $2563.6
  • Product name: Calcitonin
  • CAS: 9007-12-9
  • MF: C145H240N44O48S2
  • MW: 3431.85
  • EINECS:232-693-2
  • MDL Number:MFCD00133860
  • Synonyms:calcimar(salmon) ;calcitar ;calcitrin ;SALMON;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7)
33 prices
Selected condition:
Brand
  • Biorbyt Ltd
  • Usbiological
Package
  • 50ug
  • 100ug
  • 1mg
  • 5mg
  • 10mg
  • 50ul
  • 100ul
  • 200ul
  • 500ul
  • 96Tests
  • ManufacturerBiorbyt Ltd
  • Product numberorb364460
  • Product descriptionCalcitonin > 95%
  • Packaging1mg
  • Price$691.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364460
  • Product descriptionCalcitonin > 95%
  • Packaging5mg
  • Price$1713.6
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364460
  • Product descriptionCalcitonin > 95%
  • Packaging10mg
  • Price$2563.6
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number227256
  • Product descriptionCalcitonin PurifiedbyProteinAaffinitychromatographyfromcellculture.
  • Packaging1mg
  • Price$1190
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-08B
  • Product descriptionCalcitonin Supernatant
  • Packaging500ul
  • Price$1359
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-16A-PE
  • Product descriptionCalcitonin
  • Packaging100ul
  • Price$1020
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number308768
  • Product descriptionCalcitonin Purifiedbyimmunoaffinitychromatography.
  • Packaging50ug
  • Price$403
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-29
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-24
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-27
  • Product descriptionCalcitonin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number308768
  • Product descriptionCalcitonin Purifiedbyimmunoaffinitychromatography.
  • Packaging100ug
  • Price$531
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product number398659
  • Product descriptionCalcitonin Purifiedbyimmunoaffinitychromatography.
  • Packaging50ul
  • Price$531
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product number545581
  • Product descriptionCalcitonin PurifiedbyProteinA/Gaffinitychromatography.
  • Packaging200ul
  • Price$578
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product number545582
  • Product descriptionCalcitonin PurifiedbyProteinGaffinitychromatography.
  • Packaging200ul
  • Price$559
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product number545583
  • Product descriptionCalcitonin PurifiedbyProteinAandpeptideaffinitychromatography.
  • Packaging200ul
  • Price$546
  • Updated2026-06-03
  • Buy
  • ManufacturerUsbiological
  • Product numberC0115-23
  • Product descriptionCalcitonin
  • Packaging5mg
  • Price$691
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Biorbyt Ltd orb364460 Calcitonin > 95% 1mg $691.9 2021-12-16 Buy
Biorbyt Ltd orb364460 Calcitonin > 95% 5mg $1713.6 2021-12-16 Buy
Biorbyt Ltd orb364460 Calcitonin > 95% 10mg $2563.6 2021-12-16 Buy
Usbiological 227256 Calcitonin PurifiedbyProteinAaffinitychromatographyfromcellculture. 1mg $1190 2026-06-03 Buy
Usbiological C0115-08B Calcitonin Supernatant 500ul $1359 2026-06-03 Buy
Usbiological C0115-16A-PE Calcitonin 100ul $1020 2021-12-16 Buy
Usbiological 308768 Calcitonin Purifiedbyimmunoaffinitychromatography. 50ug $403 2026-06-03 Buy
Usbiological C0115-29 Calcitonin 1mg $531 2021-12-16 Buy
Usbiological C0115-24 Calcitonin 1mg $531 2021-12-16 Buy
Usbiological C0115-27 Calcitonin 1mg $531 2021-12-16 Buy
Usbiological 308768 Calcitonin Purifiedbyimmunoaffinitychromatography. 100ug $531 2026-06-03 Buy
Usbiological 398659 Calcitonin Purifiedbyimmunoaffinitychromatography. 50ul $531 2026-06-03 Buy
Usbiological 545581 Calcitonin PurifiedbyProteinA/Gaffinitychromatography. 200ul $578 2026-06-03 Buy
Usbiological 545582 Calcitonin PurifiedbyProteinGaffinitychromatography. 200ul $559 2026-06-03 Buy
Usbiological 545583 Calcitonin PurifiedbyProteinAandpeptideaffinitychromatography. 200ul $546 2026-06-03 Buy
Usbiological C0115-23 Calcitonin 5mg $691 2021-12-16 Buy

Properties

storage temp. :−20°C
solubility :0.05 M acetic acid: 1 mg/mL, clear, colorless
form :powder

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Calcitonin has been approved for the treatment of postmenopausal osteoporosis, hypercalcemia of malignancy, and Paget's disease of the bone.Several sources are available (e.g., eel, human, salmon, and porcine). The calcitonin isolated from salmon is the preferred source, because it has greater receptor affinity and a longer half-life than the human hormone.

More related product prices

Calcitonin salmon

Related product price