Calcitonin
|
- $403 - $2563.6
- Product name: Calcitonin
- CAS: 9007-12-9
- MF: C145H240N44O48S2
- MW: 3431.85
- EINECS:232-693-2
- MDL Number:MFCD00133860
- Synonyms:calcimar(salmon) ;calcitar ;calcitrin ;SALMON;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7)
33 prices
Selected condition:
Brand
- Biorbyt Ltd
- Usbiological
Package
- 50ug
- 100ug
- 1mg
- 5mg
- 10mg
- 50ul
- 100ul
- 200ul
- 500ul
- 96Tests
- ManufacturerBiorbyt Ltd
- Product numberorb364460
- Product descriptionCalcitonin > 95%
- Packaging1mg
- Price$691.9
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364460
- Product descriptionCalcitonin > 95%
- Packaging5mg
- Price$1713.6
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364460
- Product descriptionCalcitonin > 95%
- Packaging10mg
- Price$2563.6
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number308768
- Product descriptionCalcitonin Purifiedbyimmunoaffinitychromatography.
- Packaging50ug
- Price$403
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product numberC0115-08B
- Product descriptionCalcitonin Supernatant
- Packaging500ul
- Price$1359
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product numberC0115-29
- Product descriptionCalcitonin
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-24
- Product descriptionCalcitonin
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-27
- Product descriptionCalcitonin
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number308768
- Product descriptionCalcitonin Purifiedbyimmunoaffinitychromatography.
- Packaging100ug
- Price$531
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product number398659
- Product descriptionCalcitonin Purifiedbyimmunoaffinitychromatography.
- Packaging50ul
- Price$531
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product number545583
- Product descriptionCalcitonin PurifiedbyProteinAandpeptideaffinitychromatography.
- Packaging200ul
- Price$546
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product number545582
- Product descriptionCalcitonin PurifiedbyProteinGaffinitychromatography.
- Packaging200ul
- Price$559
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product number545581
- Product descriptionCalcitonin PurifiedbyProteinA/Gaffinitychromatography.
- Packaging200ul
- Price$578
- Updated2026-06-03
- Buy
- ManufacturerUsbiological
- Product numberC0115-23
- Product descriptionCalcitonin
- Packaging5mg
- Price$691
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-26
- Product descriptionCalcitonin
- Packaging5mg
- Price$691
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-28
- Product descriptionCalcitonin
- Packaging1mg
- Price$701
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Biorbyt Ltd | orb364460 | Calcitonin > 95% | 1mg | $691.9 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364460 | Calcitonin > 95% | 5mg | $1713.6 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364460 | Calcitonin > 95% | 10mg | $2563.6 | 2021-12-16 | Buy |
| Usbiological | 308768 | Calcitonin Purifiedbyimmunoaffinitychromatography. | 50ug | $403 | 2026-06-03 | Buy |
| Usbiological | C0115-08B | Calcitonin Supernatant | 500ul | $1359 | 2026-06-03 | Buy |
| Usbiological | C0115-29 | Calcitonin | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | C0115-24 | Calcitonin | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | C0115-27 | Calcitonin | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | 308768 | Calcitonin Purifiedbyimmunoaffinitychromatography. | 100ug | $531 | 2026-06-03 | Buy |
| Usbiological | 398659 | Calcitonin Purifiedbyimmunoaffinitychromatography. | 50ul | $531 | 2026-06-03 | Buy |
| Usbiological | 545583 | Calcitonin PurifiedbyProteinAandpeptideaffinitychromatography. | 200ul | $546 | 2026-06-03 | Buy |
| Usbiological | 545582 | Calcitonin PurifiedbyProteinGaffinitychromatography. | 200ul | $559 | 2026-06-03 | Buy |
| Usbiological | 545581 | Calcitonin PurifiedbyProteinA/Gaffinitychromatography. | 200ul | $578 | 2026-06-03 | Buy |
| Usbiological | C0115-23 | Calcitonin | 5mg | $691 | 2021-12-16 | Buy |
| Usbiological | C0115-26 | Calcitonin | 5mg | $691 | 2021-12-16 | Buy |
| Usbiological | C0115-28 | Calcitonin | 1mg | $701 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :0.05 M acetic acid: 1 mg/mL, clear, colorless
form :powder
solubility :0.05 M acetic acid: 1 mg/mL, clear, colorless
form :powder
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Calcitonin has been approved for the treatment of postmenopausal osteoporosis, hypercalcemia of malignancy, and Paget's disease of the bone.Several sources are available (e.g., eel, human, salmon, and porcine). The calcitonin isolated from salmon is the preferred source, because it has greater receptor affinity and a longer half-life than the human hormone.More related product prices
Calcitonin salmonRelated product price
-
Elcatonin
$159-1831 -
CALCITONIN, RAT
$55-1515.6 -
CALCITONIN (PORCINE)
$130-2750
Suppliers and manufacturers
Phygene
3B Pharmachem (Wuhan) International Co.,Ltd.
GL Biochem (Shanghai) Ltd
Beijing HuaMeiHuLiBiological Chemical
Hubei XinyuanShun Chemical Co., Ltd.
Wuxi Zhongkun Biochemical Technology Co., Ltd.
NINGBO INNO PHARMCHEM CO.,LTD.
Nanjing Peptide Biotech Ltd.
Hangzhou Peptidego Biotech Co.,Ltd.
Hubei Xinyuanshun Pharmaceutical Chemical Co., Ltd.




