Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> Parstatin (human)

Parstatin (human)

Parstatin (human) price.
  • $352 - $692
  • Product name: Parstatin (human)
  • CAS: 1065755-99-8
  • MF: C191H330N64O53S3
  • MW: 0
  • EINECS:
  • MDL Number:
  • Synonyms:Parstatin (human);MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR;Parstatin (human) TFA
Price3 Properties Safety Information Description
3 prices
Selected condition：
Brand
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Tocris
Package
  • 1
  • 1mg
  • 5MG
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0004614
  • Product descriptionPARSTATIN-HUMAN 95.00%
  • Packaging5MG
  • Price$504.42
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5450
  • Product descriptionParstatin(human)
  • Packaging1mg
  • Price$692
  • Updated2021-12-16
  • Buy
  • ManufacturerTocris
  • Product number3553
  • Product descriptionParstatin(human)
  • Packaging1
  • Price$352
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
American Custom Chemicals Corporation PEP0004614 PARSTATIN-HUMAN 95.00% 5MG $504.42 2021-12-16 Buy
ApexBio Technology B5450 Parstatin(human) 1mg $692 2021-12-16 Buy
Tocris 3553 Parstatin(human) 1 $352 2021-12-16 Buy

Properties

storage temp. :Store at -20°C
form :Powder
Water Solubility :Soluble to 1 mg/ml in water

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50~ 3μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activityin vitro. Inhibits angiogenesis and exhibits cardioprotective activityin vivo.

More related product prices

Parstatin (mouse)

Related product price

Suppliers and manufacturers

Shenzhen Nexconn Pharmatechs Ltd
BOC Sciences
Aladdin Scientific
Changsha MOL Changes Biotechnology Co., Ltd. 3B Pharmachem (Wuhan) International Co.,Ltd. Creative Peptides Chengdu Youngshe Chemical Co., Ltd. Hangzhou Peptidego Biotech Co.,Ltd. BOC Sciences Gill polypeptide biopharmaceutical (dalian) co., LTD