Welcome to chemicalbook!
China English Japan Germany
400-158-6606
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structured search
Inquriy
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook My chemicalbook

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> Teriparatide acetate

Teriparatide acetate

Teriparatide acetate price.
  • $88 - $5690
  • Product name: Teriparatide acetate
  • CAS: 52232-67-4
  • MF: C172H278N52O47S2
  • MW: 3890.49792
  • EINECS:640-978-1
  • MDL Number:MFCD00149013
  • Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
Price24 Properties Safety Information Description
24 prices
Selected condition：
Brand
  • Alfa Aesar
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Chemenu
  • Crysdot
  • Medical Isotopes, Inc.
  • Sigma-Aldrich
  • Tocris
  • TRC
Package
  • 1
  • 23-5501-1mg
  • 0.1mg
  • 0.5mg
  • 1mg
  • 5mg
  • 10mg
  • 25mg
  • Y0001916
  • 50mg
  • 100mg
  • ManufacturerAlfa Aesar
  • Product numberJ66180
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging0.5mg
  • Price$148
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66180
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging1mg
  • Price$259
  • Updated2023-06-20
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberSHG0006488
  • Product descriptionPARATHYROID HORMONE (1-34) 95.00%
  • Packaging1MG
  • Price$883.11
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging1mg
  • Price$88
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging5mg
  • Price$132
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging10mg
  • Price$167
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging25mg
  • Price$375
  • Updated2021-12-16
  • Buy
  • ManufacturerChemenu
  • Product numberCM101690
  • Product descriptionTeriparatide 97%
  • Packaging50mg
  • Price$290
  • Updated2021-12-16
  • Buy
  • ManufacturerChemenu
  • Product numberCM101690
  • Product descriptionTeriparatide 97%
  • Packaging100mg
  • Price$561
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging5mg
  • Price$99
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging10mg
  • Price$149
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging25mg
  • Price$248
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging50mg
  • Price$396
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging100mg
  • Price$594
  • Updated2021-12-16
  • Buy
  • ManufacturerMedical Isotopes, Inc.
  • Product number17715
  • Product descriptionTeriparatide
  • Packaging25mg
  • Price$5690
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberP3796
  • Product descriptionParathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder
  • Packaging0.1mg
  • Price$178
  • Updated2024-03-01
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J66180 Parathyroid Hormone (1-34), human 0.5mg $148 2021-12-16 Buy
Alfa Aesar J66180 Parathyroid Hormone (1-34), human 1mg $259 2023-06-20 Buy
American Custom Chemicals Corporation SHG0006488 PARATHYROID HORMONE (1-34) 95.00% 1MG $883.11 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 1mg $88 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 5mg $132 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 10mg $167 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 25mg $375 2021-12-16 Buy
Chemenu CM101690 Teriparatide 97% 50mg $290 2021-12-16 Buy
Chemenu CM101690 Teriparatide 97% 100mg $561 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 5mg $99 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 10mg $149 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 25mg $248 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 50mg $396 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 100mg $594 2021-12-16 Buy
Medical Isotopes, Inc. 17715 Teriparatide 25mg $5690 2021-12-16 Buy
Sigma-Aldrich P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 0.1mg $178 2024-03-01 Buy
Next Last

Properties

Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)

Safety Information

Symbol(GHS): GHS hazard pictograms
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H227 Combustible liquid Flammable liquids Category 4 Warning P210, P280, P370+P378, P403+P235,P501
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning GHS hazard pictograms P264, P270, P301+P312, P330, P501
Precautionary statements:
P210 Keep away from heat/sparks/open flames/hot surfaces. — No smoking.
P264 Wash hands thoroughly after handling.
P264 Wash skin thouroughly after handling.
P270 Do not eat, drink or smoke when using this product.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P301+P312 IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell.
P330 Rinse mouth.
P370+P378 In case of fire: Use … for extinction.
P403+P235 Store in a well-ventilated place. Keep cool.
P501 Dispose of contents/container to..…

Description

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

More related product prices

Oxytocin Melanotan II Cosyntropin N-(N-(N-Glycylglycyl)glycyl)-8-L-lysinevasopressin Angiotensin acetate Pramlintide acetate Desmopressin Triptorelin acetate 86220-42-0 Ganirelix Leuprorelin acetate Eptifibatide Eledoisin VAPREOTIDE Leuprorelin 37025-55-1 Argipressine

Related product price

Suppliers and manufacturers

qingdao future trading Co., Ltd
TeripaRatide Acetate peptide
$900.00 /1gram
TeripaRatide Acetate peptide CAS:52232-67-4
Hebei Xinsheng New Material Technology Co., LTD.
Teriparatide acetate Powder
$0.00 /1kg
Teriparatide acetate Powder CAS:52232-67-4
Zibo Hangyu Biotechnology Development Co., Ltd
Teriparatide acetate
$90.00 /1KG
Teriparatide acetate CAS:52232-67-4
Hebei Anlijie Biotechnology Co., Ltd
Teriparatide
$1000.00 /1G
Teriparatide CAS:52232-67-4
Hebei Weimiao Import and Export Trade Co., Ltd.
Teriparatide
$160.00 /10Box
Teriparatide CAS:52232-67-4
Shanghai Getian Industrial Co., LTD
Teriparatide acetate
$26.00 /1box
Teriparatide acetate CAS:52232-67-4
Shanghai Chinqesen Biotechnology Co., Ltd.
Teriparatide acetate
$20.00/kg
Teriparatide acetate CAS:52232-67-4
Shanghai Yunao International Trade Co., Ltd
pTH (1-34) (human) acetate salt
$0.00 /1g
pTH (1-34) (human) acetate salt CAS:52232-67-4
Zhejiang Hangyu API Co., Ltd
Cellmano Biotech Limited