Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> GALANIN, PORCINE

GALANIN, PORCINE

GALANIN, PORCINE price.
  • $191 - $701
  • Product name: GALANIN, PORCINE
  • CAS: 88813-36-9
  • MF: C146H213N43O40
  • MW: 3210.52
  • EINECS:
  • MDL Number:MFCD00133353
  • Synonyms:GALANIN PORCINEGALANIN POR;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2;GALANIN (PIG);GALANIN, PORCINE;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2;GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2;Ccris 6750;Galanin(1-29) porcine
24 prices
Selected condition:
Brand
  • AK Scientific
  • Alfa Aesar
  • ApexBio Technology
  • Biosynth Carbosynth
  • Tocris
  • Usbiological
Package
  • 10ug
  • 500ug
  • 0.5mg
  • 1
  • 1mg
  • 200ul
  • ManufacturerAK Scientific
  • Product numberG877
  • Product descriptionGalanin, porcine
  • Packaging1mg
  • Price$433
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66251
  • Product descriptionGalanin human
  • Packaging1mg
  • Price$342
  • Updated2023-06-20
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66251
  • Product descriptionGalanin human
  • Packaging0.5mg
  • Price$191
  • Updated2023-06-20
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66770
  • Product descriptionGalanin, porcine
  • Packaging0.5mg
  • Price$230
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66770
  • Product descriptionGalanin, porcine
  • Packaging1mg
  • Price$357
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5360
  • Product descriptionGalanin, porcine
  • Packaging1mg
  • Price$574
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFG10443
  • Product descriptionGalanin
  • Packaging500ug
  • Price$360
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFG10443
  • Product descriptionGalanin
  • Packaging1mg
  • Price$628
  • Updated2021-12-16
  • Buy
  • ManufacturerTocris
  • Product number3008
  • Product descriptionGalanin, porcine
  • Packaging1
  • Price$388
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberG1043-16G
  • Product descriptionGalanin
  • Packaging1mg
  • Price$303
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number154705
  • Product descriptionGalanin
  • Packaging10ug
  • Price$339
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number154706
  • Product descriptionGalanin
  • Packaging10ug
  • Price$339
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberG1043-16H
  • Product descriptionGalanin
  • Packaging1mg
  • Price$396
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number140375
  • Product descriptionGalanin
  • Packaging200ul
  • Price$436
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberG1043-16K
  • Product descriptionGalanin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberG1043-16S
  • Product descriptionGalanin
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
AK Scientific G877 Galanin, porcine 1mg $433 2021-12-16 Buy
Alfa Aesar J66251 Galanin human 1mg $342 2023-06-20 Buy
Alfa Aesar J66251 Galanin human 0.5mg $191 2023-06-20 Buy
Alfa Aesar J66770 Galanin, porcine 0.5mg $230 2021-12-16 Buy
Alfa Aesar J66770 Galanin, porcine 1mg $357 2021-12-16 Buy
ApexBio Technology B5360 Galanin, porcine 1mg $574 2021-12-16 Buy
Biosynth Carbosynth FG10443 Galanin 500ug $360 2021-12-16 Buy
Biosynth Carbosynth FG10443 Galanin 1mg $628 2021-12-16 Buy
Tocris 3008 Galanin, porcine 1 $388 2021-12-16 Buy
Usbiological G1043-16G Galanin 1mg $303 2021-12-16 Buy
Usbiological 154705 Galanin 10ug $339 2021-12-16 Buy
Usbiological 154706 Galanin 10ug $339 2021-12-16 Buy
Usbiological G1043-16H Galanin 1mg $396 2021-12-16 Buy
Usbiological 140375 Galanin 200ul $436 2021-12-16 Buy
Usbiological G1043-16K Galanin 1mg $531 2021-12-16 Buy
Usbiological G1043-16S Galanin 1mg $531 2021-12-16 Buy

Properties

Density :1.50±0.1 g/cm3(Predicted)
RTECS :LW5952050
storage temp. :−20°C
form :powder
Water Solubility :Soluble to 0.50 mg/ml in water
Sequence :H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Galanin porcine has been used for the pre-absorption of anti-Gal serum, as control, to determine the specificity of immunoreaction during immunocytochemistry on brains obtained from river lampreys (Lampetra fluviatilisL.).

Related product price