Identification | Back Directory | [Name]
H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH | [CAS]
106612-94-6 | [Synonyms]
Tglp-1 GLP-1, 7-37 HuMan GLP-1 Glp-I (7-37) insulinotropin Human GLP-1 (7-37) GLP-1 (7-37) (HUMAN) Preproglucagon 78-108 Insulinotropin (human) 7-37-Glucagon-likepeptide GLP-1(7-38), Insulinotropin PREPROGLUCAGON 78-108 HUMAN GLUCAGON-LIKE PEPTIDE 1 (7-37) Glucagon like peptide I (7-37) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 7-37-Glucagon-like peptide I (human) GLP-1, 7-37, Preproglucagon 78-108 GLUCAGON LIKE PEPTIDE-I (7-37), HUMAN GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN) GLUCAGON-LIKE PEPTIDE 1, FRAGMENT 7-37 HUMAN GLP-1 (7-37) Acetate | Glucagon-Like Peptide 1 Peptide GLP-1 (human glucose-lowering peptide-1) GLP-1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) l-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alany PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH acetate salt L-Histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alany
Glucagon-related peptide (oncorhynchus kisutch), 3-L-glutamic acid-6-L-phenylalanine-9-L-aspartic acid-12-L-serine-15-L-glutamic acid-16-glycine-21-L-isoleucine-24-L-alanine-27-L-valine-28-L-lysine-31-glycine- Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) GLP-1 (7-37) (huMan, bovine, guinea pig, Mouse, rat)
Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucag | [Molecular Formula]
C151H228N40O47 | [MDL Number]
MFCD00167940 | [MOL File]
106612-94-6.mol | [Molecular Weight]
3355.67 |
Chemical Properties | Back Directory | [density ]
1.48±0.1 g/cm3(Predicted) | [storage temp. ]
−20°C
| [solubility ]
Water:30.0(Max Conc. mg/mL);8.34(Max Conc. mM) | [form ]
Lyophilized powder | [Water Solubility ]
Soluble in water at 2mg/ml | [Sequence]
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH | [CAS DataBase Reference]
106612-94-6 |
Hazard Information | Back Directory | [Description]
GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.
| [Uses]
Glucagon-Like Peptide 1 Fragment 7-37 human has been used:
- as a positive control for insulin secretion of pancreatic islets
- to test its effect on insulin response in horse islets
- in combination with mesenchymal stem cells (MSCs) test its protective effects in myocardial infarction
| [General Description]
Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) is an amino-truncated form of GLP-1. | [Biochem/physiol Actions]
Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) interacts with the GLP-1 receptor (GLP-1r). It mediates insulin release by stimulating the cyclic AMP accumulation in islet cells GLP-l(7-37) is a potential therapeutic agent due to its insulin-secretagogue functionality. | [in vitro]
In vitro, truncated glucagon-like peptides [GLP-1(7-36)-amide and GLP-1(7-37)] increase insulin secretion in a glucose-dependent manner, and desensitization to the action of GLP-1(7-37) has been demonstrated acutely with high concentrations. | [in vivo]
GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats.
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM. | [storage]
Store at -20°C,protect from light |
|
|