Identification | Back Directory | [Name]
(GLN11)-AMYLOID BETA-PROTEIN (1-28) | [CAS]
106686-61-7 | [Synonyms]
[GLN11]-BETA-AMYLOID (1-28) [GLN11]-BETA-AMYLOID (1-40) DAEFRHDSGYQVHHQKLVFFAEDVGSNK Amyloidβ-ProteinFragment1-28 AMyloid b-Protein (1-28) E11Q amyloid β-protein fragment 1-28 (Gln11)-AMyloid b-Protein (1-28) (Gln11)-Amyloid β-Protein (1-28) (GLN11)-AMYLOID BETA-PROTEIN (1-28) (gln11)-amyloid B-protein fragment 1-28 DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV BETA-AMYLOID PEPTIDE (1-40, GLN11), HUMAN (GLN11)-AMYLOID BETA-PROTEIN (1-28) USP/EP/BP 776:PN:US20090175821 SEQID:976 claimed protein B-AMYLOID PROTEIN (GLN11) 1-28) >97% SYN THETIC (Gln11)-AMyloid β-Protein (1-28)
AMyloid β-Protein (1-28) E11Q (Gln11)-AMyloid β-Protein (1-28) AMyloid β-Protein (1-28) E11Q H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLN-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-OH L-Lysine, L-α-aspartyl-L-alanyl-L-α-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-α-aspartyl-L-serylglycyl-L-tyrosyl-L-glutaminyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-α-glutamyl-L-α-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl- | [Molecular Formula]
C145H210N42O45 | [MDL Number]
MFCD00133078 | [MOL File]
106686-61-7.mol | [Molecular Weight]
3261.47 |
Hazard Information | Back Directory | [Uses]
[Gln11] Amyloid beta (1-28) Aβ(s) peptides, their peptide fragments and mutated fragments are used to study a wide range of metabolic and regulatory functions including activation of kinases, regulation of cholesterol transport, function as a transcription factor, and regulators of inflammation. Aβ(s) peptides and their peptide fragments are also used to study oxidative stress, metal binding and mechanisms of protein cross-linking in the context of diseases such as Alzheimer?s disease and neurodegeneration. |
|
Company Name: |
cjbscvictory
|
Tel: |
13348960310 13348960310 |
Website: |
http://www.weikeqi-biotech.com/ |
|