Identification | Back Directory | [Name]
H-SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 | [CAS]
235433-36-0 | [Synonyms]
PRRP31 PRRP20 PRRP20 (HUMAN) PRRP31 (HUMAN) TPDINPAWYASRGIRPVGRF-NH2 PREPROLACTIN (23-53) (HUMAN) PREPROLACTIN (34-53) (HUMAN) PROLACTIN-RELEASING PEPTIDE (1-31) SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 PROLACTIN-RELEASING PEPTIDE (HUMAN) PROLACTIN-RELEASING PEPTIDE (12-31) Prolactin-releasing peptide-20 (human) 12-31-Human prolactin-releasing peptide PROLACTIN RELEASING PEPTIDE (1-31), HUMAN PROLACTIN-RELEASING PEPTIDE (12-31) (HUMAN) PrRP20 (huMan), Preprolactin (34-53) (huMan) Prolactin-releasing peptide human, ≥97% (HPLC) Prolactin-releasing Peptide Fragment 12-31 rat Prolactin-releasing Peptide Fragment 12-31 human THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 H-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 H-SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 L-Phenylalaninamide, L-threonyl-L-prolyl-L-α-aspartyl-L-isoleucyl-L-asparaginyl-L-prolyl-L-alanyl-L-tryptophyl-L-tyrosyl-L-alanyl-L-seryl-L-arginylglycyl-L-isoleucyl-L-arginyl-L-prolyl-L-valylglycyl-L-arginyl- | [Molecular Formula]
C104H158N32O26 | [MDL Number]
MFCD02094631 | [MOL File]
235433-36-0.mol | [Molecular Weight]
2272.57 |
Chemical Properties | Back Directory | [density ]
1.50±0.1 g/cm3(Predicted) | [storage temp. ]
−20°C
| [form ]
Solid | [color ]
White to off-white | [Sequence]
Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
Hazard Information | Back Directory | [Uses]
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. | [in vivo]
Following intracerebroventricular injection of Prolactin Releasing Peptide (1-31), human 5 nM there is a highly significant simulation of plasma LH that began at 10 minutes and is maintained over the course of the experiment. Plasma FSH increased at 20 minutes following ICV injection. Total plasma testosterone increased at 60 minutes post injection[3]. | [References]
[1] Roland BL, et al. Anatomical distribution of prolactin-releasing peptide and its receptor suggests additional functions in the central nervous system and periphery. Endocrinology. 1999 Dec;140(12):5736-45. DOI:10.1210/endo.140.12.7211 [2] Langmead CJ, et al. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. Br J Pharmacol. 2000 Oct;131(4):683-8. DOI:10.1038/sj.bjp.0703617 [3] Seal LJ, et al. Prolactin releasing peptide (PrRP) stimulates luteinizing hormone (LH) and follicle stimulating hormone (FSH) via a hypothalamic mechanism in male rats. Endocrinology. 2000 May;141(5):1909-12. DOI:10.1210/endo.141.5.7528 |
|
|