| Identification | Back Directory | [Name]
APELIN-36 (HUMAN) | [CAS]
252642-12-9 | [Synonyms]
Apelin (human) APELIN-36 (HUMAN) M.W. 4195.83 C184H297N69O43S LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH L-Leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine | [Molecular Formula]
C184H295N69O42R2S | [MDL Number]
MFCD01865608 | [MOL File]
252642-12-9.mol | [Molecular Weight]
4177.81 |
| Chemical Properties | Back Directory | [storage temp. ]
-15°C | [solubility ]
DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml | [form ]
Lyophilized powder | [color ]
White to off-white | [Water Solubility ]
Soluble in water at 1mg/ml | [Sequence]
Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe |
| Hazard Information | Back Directory | [Uses]
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3][4]. | [IC 50]
HIV-1; HIV-2 | [storage]
Desiccate at -20°C | [References]
[1] Tatemoto K, Hosoya M, Habata Y, et al. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem Biophys Res Commun. 1998;251(2):471-476. DOI:10.1006/bbrc.1998.9489 [2] Medhurst AD, Jennings CA, Robbins MJ, et al. Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J Neurochem. 2003;84(5):1162-1172. DOI:10.1046/j.1471-4159.2003.01587.x [3] Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H. Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 2000;473(1):15-18. DOI:10.1016/s0014-5793(00)01487-3 [4] Galon-Tilleman H, Yang H, Bednarek MA, et al. Apelin-36 Modulates Blood Glucose and Body Weight Independently of Canonical APJ Receptor Signaling. J Biol Chem. 2017;292(5):1925-1933. DOI:10.1074/jbc.M116.748103 |
|
|