| Identification | Back Directory | [Name]
CECROPIN A | [CAS]
80451-04-3 | [Synonyms]
CECROPIN A CECROPIN A, PORCINE CECROPIN A USP/EP/BP Cecropin A?/Cecropin A, porcine KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2 H-LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2 Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 | [Molecular Formula]
C184H313N53O46 | [MDL Number]
MFCD00130752 | [MOL File]
80451-04-3.mol | [Molecular Weight]
4003.78 |
| Chemical Properties | Back Directory | [storage temp. ]
-20°C | [form ]
powder
| [color ]
White to off-white | [Water Solubility ]
Water : ≥ 50 mg/mL (12.14 mM) | [Sequence]
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
| Hazard Information | Back Directory | [Uses]
Cecropin A has been used as an antimicrobial peptide (AMP):
- to test its cytotoxic effect on breast adenocarcinoma (MDA-MB-231) and human mesothelioma (M14K) cell lines
- in ultrasensitive radial diffusion assay against E coli to test Galleria mellonella protein 24 and apolipophorin III effects
- to test its minimal inhibitory concentrations (MICs) in sensitivity assay for Photorhabdus variants
| [Uses]
Cecropin A is an antibacterial peptide originally identified in moths. | [General Description]
Cecropin A belongs to cecropin class and comprises 37 amino acid residues in L configuration. Structurally, this peptide has a C-terminal hydrophobic α-helical structure and the amphipathic N-terminal end. Cecropin A is linear and cationic in nature. | [Biochem/physiol Actions]
Cecropin A interacts with cell membranes and makes it permeable for electrolytes. Cecropin A thus, favors cytolysis and finally cell death in the hepatocellular carcinoma and lymphoma. The synthetic cecropin A in transgenic rice confers protection against bacterial as well as fungal pathogens. |
|
|