LL-37

LL-37 Struktur
154947-66-7
CAS-Nr.
154947-66-7
Englisch Name:
LL-37
Synonyma:
II37 Peptide;LL-37, LL37, CAMP;Cathelicidin LL-37;LL-37 5mg (CAP-18);LL-37 human acetate;LL-37 (LL37)PEPTIDE;LL-37 (Cathelicidin);LL37 (Human cathelicidin);Cathelicidin LL 37 (human);LL-37 ( Human) (0.1mg vial)
CBNumber:
CB02603131
Summenformel:
C205H340N60O53
Molgewicht:
0
MOL-Datei:
Mol file

LL-37 Eigenschaften

Löslichkeit
Water: 1 mg/ml
Aggregatzustand
A lyophilized powder
Farbe
White to off-white
Wasserlöslichkeit
Soluble to 1 mg/ml in water
Sequenz
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
InChIKey
POIUWJQBRNEFGX-XAMSXPGMSA-N

Sicherheit

LL-37 Chemische Eigenschaften,Einsatz,Produktion Methoden

Beschreibung

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Verwenden

L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.

benefits

LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity.  Significantly boosts immune function; Fights inflammation; Prevents cancer progression; Accelerates wound healing; Lowers the risk of heart disease; Prevents lung injury; Promotes bone repair.

Biologische Aktivität

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Nebenwirkungen

LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following:
Increased inflammation
Induction of autoimmune disease
Depression
Damage to sperm surface membranes

Einzelnachweise

[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823
[2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733
[3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147
[4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL?37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035
[5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.

LL-37 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


LL-37 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 149)Lieferanten
Firmenname Telefon E-Mail Land Produktkatalog Edge Rate
Shanghai Getian Industrial Co., LTD
+86-15373193816
mike@ge-tian.com China 269 58
Strong peptide cross-border e-commerce Co. LTD
+undefined13930052870
qt01@qiangtaipharm.com China 84 58
Qingdao Xinli Technology Development Co., Ltd.
+8616632313095
xinlikeji01@qdxlchem.com China 124 58
Shandong Huizhihan Supply Chain Co., Ltd
+86-13363081709 +86-13363000288
3957328362@qq.com China 115 58
Kebeilai Pharmaceutical Biotech Co., Ltd.
+86-18240866958
wangjasmine7289@gmail.com China 1022 58
Hebei Jiafan Trading Company Limited
+86-15354498258; +8615354498258
sales01@jiafan88.com China 180 58
Ningbo Qingteng Plastic Cost.,Ltd.
15383911577
admin@nbqingteng.com China 312 58
Hebei Sidaner Technology Co., Ltd.
+86-86-15732938890 +8615732938890
18631999880a@gmail.com China 113 58
RongNa Biotechnology Co.,Ltd
+86-86-13583358881 +8618560316533
Brad@rongnabiotech.com China 3387 58
Shanghai Yunao International Trade Co., Ltd
+8617621705551
asdf@shanghaihg.cn China 264 58

  • Antibacterial Protein LL-37 (huMan), LL37, CAMP
  • H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
  • Antibacterial Protein LL-37 (human)
  • LL-37 (trifluoroacetate salt)
  • [LL-37, 37 aa]
  • Cathelicidin LL 37 (human)
  • LL-37, LL37, CAMP
  • LL-37 human acetate
  • Cathelicidin LL-37
  • Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37
  • II37 Peptide
  • LL37 (Human cathelicidin)
  • LL-37, Antimicrobial Peptide, human - 1 mg
  • LL-37 5mg (CAP-18)
  • LL-37 ( Human) (0.1mg vial)
  • LL-37 (Cathelicidin)
  • LL-37 (LL37)PEPTIDE
  • 154947-66-7
  • C205H340N60O53
Copyright 2019 © ChemicalBook. All rights reserved