ChemicalBook
Chinese english Germany Japanese Korea

Exendin-4 Produkt Beschreibung

Exendin-4 Struktur
141758-74-9
CAS-Nr.
141758-74-9
Englisch Name:
Exendin-4
Synonyma:
EXENDIN-4;Exendin-4 Exenatide;Exenatide (Exendin-4);M.W. 4186.61 C184H282N50O60S;Exenatide, AC 2993, Exendin A, ExendinA;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
CBNumber:
CB7738335
Summenformel:
C184H282N50O60S
Molgewicht:
4186.57188
MOL-Datei:
141758-74-9.mol

Exendin-4 Eigenschaften

RTECS-Nr.
VT9545000
storage temp. 
−20°C
Aggregatzustand
White to off-white solid.

Sicherheit

WGK Germany  3
HS Code  2933290000

Exendin-4 Chemische Eigenschaften,Einsatz,Produktion Methoden

Beschreibung

Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. The dosing regimen for exenatide is 5 or 10 mg twice daily, administered as a subcutaneous injection within an hour before morning and evening meals. Following subcutaneous administration, peak plasma concentrations of exenatide are reached in 2.1 h, and the plasma pharmacokinetic profile is dose proportional. The most common adverse events reported with exenatide include nausea, vomiting, diarrhea, feeling jittery, dizziness, headache, and dyspepsia.

Originator

Amylin (US)

Verwenden

Antidiabetic.

Definition

ChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.

Trademarks

Byetta

Exendin-4 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


Exendin-4 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 111)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Alpha Biopharmaceuticals Co., Ltd
0086-411-39042497
0086-411-39042693 sales@alphabiopharm.com China 921 58
Henan DaKen Chemical CO.,LTD.
+86-371-55531817
info@dakenchem.com CHINA 21676 58
Henan Tianfu Chemical Co.,Ltd.
0371-55170693
0371-55170693 info@tianfuchem.com CHINA 20672 55
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 30001 58
SUZHOU TIANMA PHARMA GROUP TIANJI BIO-PHARMACEUTICAL CO., LTD.
18315825527
kevin@tianmapharma.com CHINA 19 58
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28236 58
Chongqing Chemdad Co., Ltd
+86-13650506873
sales@chemdad.com CHINA 35440 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
Nanjing Sunlida Biological Technology Co., Ltd. 025-58378339;025-57798810
025-57019371 sales@sunlidabio.com China 3818 55

141758-74-9()Verwandte Suche:


  • EXENDIN-4
  • M.W. 4186.61 C184H282N50O60S
  • Exenatide, AC 2993, Exendin A, ExendinA
  • Exendin-4 Exenatide
  • H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
  • Exenatide (Exendin-4)
  • 141758-74-9
  • C184H282N50O60S
  • C184H282N50O60S1
  • Cell Biology
  • Cell Signaling and Neuroscience
  • BioChemical
  • Cytokines, Growth Factors and Hormones
  • Exendin
  • Hormones
  • Obesity Research
  • Peptide
  • Cytokines Growth Factors and Hormones (Obesity)
  • ExendinPeptides for Cell Biology
  • GLP-1 Receptor LigandsCell Signaling and Neuroscience
  • LizardObesity Research
  • Obesity Peptides
  • Other Obesity Research Products
  • Hormones
  • Obesity Research
  • Toxins and Venoms
  • Glucagon receptor and related
  • Peptide Receptors
  • -
Copyright 2019 © ChemicalBook. All rights reserved