ChemicalBook >> CAS DataBase List >>GALANIN, PORCINE

GALANIN, PORCINE

CAS No.
88813-36-9
Chemical Name:
GALANIN, PORCINE
Synonyms
galanin;Ccris 6750;Pig galanin;GALANIN (PIG);Porcine galanin;GALANIN, PORCINE;Porcine galanin(1-29);Galanin(1-29) porcine;Mouse Anti-GAL antibody;Rabbit Anti-GAL antibody
CBNumber:
CB3156779
Molecular Formula:
C146H213N43O40
Molecular Weight:
3210.52
MDL Number:
MFCD00133353
MOL File:
88813-36-9.mol
MSDS File:
SDS
Last updated:2024-03-27 11:49:37

GALANIN, PORCINE Properties

Density 1.50±0.1 g/cm3(Predicted)
RTECS LW5952050
storage temp. −20°C
form powder
Water Solubility Soluble to 0.50 mg/ml in water
Sequence H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2

SAFETY

Risk and Safety Statements

WGK Germany  3

GALANIN, PORCINE price More Price(25)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Alfa Aesar J66251 Galanin human 88813-36-9 0.5mg $191 2023-06-20 Buy
Alfa Aesar J66251 Galanin human 88813-36-9 1mg $342 2023-06-20 Buy
Alfa Aesar J66770 Galanin, porcine 88813-36-9 0.5mg $230 2021-12-16 Buy
Alfa Aesar J66770 Galanin, porcine 88813-36-9 1mg $357 2021-12-16 Buy
Tocris 3008 Galanin, porcine 88813-36-9 1 $388 2021-12-16 Buy
Product number Packaging Price Buy
J66251 0.5mg $191 Buy
J66251 1mg $342 Buy
J66770 0.5mg $230 Buy
J66770 1mg $357 Buy
3008 1 $388 Buy

GALANIN, PORCINE Chemical Properties,Uses,Production

Structure

GAL is a 29-aa C-terminally amidated peptide, apart from human GAL, which has 20 aa and no amidated N-terminus. The N-terminal 1–15 aa are highly conserved.  Human proGAL: Mr 13,302.1, pI 6.84. Soluble in water and physiological saline solution.
GAL

Gene, mRNA, and precursor

The GAL gene is located on human chromosome 11q13.2, rat chromosome 1q42, and mouse chromosome 19A. The peptide precursor of GAL is encoded by a single-copy gene consisting of six small exons spanning about 6 kb of genomic DNA. Regarding its structure, a sequence of GAL is followed by the signal peptide, and the remainder is called the GAL message-associated peptide (GMAP). GAL is widely expressed in the central and peripheral nervous systems in many mammalian species. In the brain, GAL is synthesized in the dorsal raphe nucleus, locus coeruleus, rostral ventrolateral medulla, central nucleus of the amygdala, paraventricular nucleus, and supraoptic nucleus. GAL is also found in the spinal cord and gut.

Synthesis and release

GAL colocalizes in vasopressin neurons and increases during salt loading, suggesting its influence on osmotically stimulated vasopressin release. GAL gene expression in magnocellular neurons is increased by estrogen.

Receptors

GAL receptors have three subtypes, referred to as GAL receptor types 1, 2, and 3 (GALR1, GALR2, and GALR3).6 The human GALR1 gene contains three exons and is translated into a 349-aa protein. The homology between species is 93% for rat and human GALR1. The expression of GALR1 is regulated by cAMP through the transcription factor CREB. Human GALR2 has 92% sequence identity to rat GALR2, although there is a 15-aa extension of the C-terminal end in human GALR2. The GALR2 gene is expressed more ubiquitously compared with that of GALR1, as it is found in several peripheral tissues, including the pituitary gland, gastrointestinal tract, skeletal muscle, heart, kidney, uterus, ovary, and testis, in addition to the central nervous system. The Galr3 transcript was first isolated from rat hypothalamic cDNA libraries. Human GALR3 consists of 368 aa and shares 36% identity with human GALR1, 58% with human GALR2, and approximately 90% with rat GALR3.

Agonists and Antagonists

M617 (GALR1), M1153, M1145 (GALR2). M35 and galantide (nonselective GALR antagonists), RWJ-57408 (GALR1), M871 (GALR2), and SNAP37889 and SNAP398299 (GALR3).

Biological functions

In rats, GALR1 is prominently distributed in the hypothalamus, amygdala, hippocampus, thalamus, brainstem, spinal cord, dorsal root ganglion (DRG), gut, heart, lung, kidney, muscle, adipocytes, and testis. GALR2 mainly exists in the cortex, hypothalamus, hippocampus, amygdala, cerebellum, DRG, heart, liver, lung, kidney, intestine, uterus, ovary, stomach, pancreas, and testis. GALR3 is found in the hypothalamus, dorsal raphe nucleus, locus coeruleus, and amygdala. GAL is thought to regulate numerous physiological processes in the adult mammalian nervous system, including sleep/wake regulation, energy and osmotic homeostasis, reproduction, nociception, and cognition.

Clinical implications

GAL increases food intake and body weight via GALR1. Intranasal administration is an effective route for the delivery of GAL-related agents into the brain by use of various cyclodextrins. Thus, the intranasal administration of a GALR1 antagonist offers an attractive approach to combat obesity. Clinical studies indicated that the GAL concentration is correlative to the morbidity of type 2 diabetes mellitus in humans. In addition, some clinical studies have shown that the activation of the GAL pathway is effective in treating type 2 diabetes.

Description

GAL is expressed in the brain and peripheral organs, and has diverse physiological actions, including energy homeostasis, reproduction, nociception, and cognition. GAL was isolated in 1983 from the porcine intestine by Tatemoto and colleagues. The GAL peptide has been purified from the chicken, alligator, and fish species, including trout, tuna, bowfin, dogfish, and sturgeon.

Biological Functions

Galanin is colocalized with acetylcholine, 5-HT , and NE in neurons or in brain regions implicated in cognitive and affective behavior, suggesting a possible role in the regulation of 5-HT and NA neurotransmission in depressive states and during the course of antidepressant therapy. Three galanin receptor subtypes have been cloned and studied, but little is known about their specific contributions to behavioral processes. In the CNS, galanin inhibits acetylcholine release, suggesting a possible role for galanin in cholinergic dysfunction; inhibits neurotransmitter release and neuronal firing rate; and inhibits signal transduction by inhibition of phosphatidyl inositol hydrolysis, leading to symptoms of depression. Thus, blocking the inhibitory effects of galanin on monoamine neurotransmitters with galanin receptor antagonists would be predicted to mimic or augment the action of the other monoamine classes of antidepressants."

Clinical Use

Since its discovery in 1983, the neuropeptide galanin has been found to be involved in a wide range of functions, including pain sensation, sexual activity, feeding, and learning and memory. Galanin is widely distributed in the central and peripheral nervous systems and in the endocrine system, and it acts as a inhibitory neuromodulator of NE and 5-HT in the brain. The 29- to 30-amino-acid sequence of galanin is conserved (almost 90% among species), indicating the importance of the molecule among species.

GALANIN, PORCINE Preparation Products And Raw materials

Raw materials

Preparation Products

GALANIN, PORCINE Suppliers

Global( 133)Suppliers
Supplier Tel Email Country ProdList Advantage
Shanghai Daken Advanced Materials Co.,Ltd
+86-371-66670886 info@dakenam.com China 16221 58
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10247 58
Hubei xin bonus chemical co. LTD
86-13657291602 linda@hubeijusheng.com CHINA 22968 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
career henan chemical co
+86-0371-86658258 15093356674; factory@coreychem.com China 29826 58
Dideu Industries Group Limited
+86-29-89586680 +86-15129568250 1026@dideu.com China 27180 58
BOC Sciences
16314854226; +16314854226 inquiry@bocsci.com United States 19743 58
Zhejiang J&C Biological Technology Co.,Limited
+1-2135480471 +1-2135480471 sales@sarms4muscle.com China 10523 58
Hangzhou Go Top Peptide Biotech
0571-88211921 sales1@gotopbio.com CHINA 2609 58
Chengdu Youngshe Chemical Co., Ltd.
+8618108235634 Cecilia@youngshechem.com China 2345 58

View Lastest Price from GALANIN, PORCINE manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
	GALANIN, PORCINE pictures 2020-02-19 GALANIN, PORCINE
88813-36-9
US $7.00 / KG 1KG 99% 100kg Career Henan Chemical Co
GALANIN PORCINEGALANIN POR H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2 GALANIN (PIG) GALANIN, PORCINE GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-HIS-ASP-LYS-TYR-GLY-LEU-ALA-NH2 GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 Ccris 6750 Galanin(1-29) porcine L-Alaninamide, glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-alpha-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-histidyl-L-alpha-aspartyl-L-lysyl-L-tyrosylglycyl-L-leucyl- Porcine galanin Porcine galanin(1-29) Pig galanin Gly-L-Trp-L-Thr-L-Leu-L-Asn-L-Ser-L-Ala-Gly-L-Tyr-L-Leu-L-Leu-Gly-L-Pro-L-His-L-Ala-L-Ile-L-Asp-L-Asn-L-His-L-Arg-L-Ser-L-Phe-L-His-L-Asp-L-Lys-L-Tyr-Gly-L-Leu-L-Ala-NH2 Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-LLe-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2 galanin GALANIN, PORCINE USP/EP/BP Galanin, porcine, ≥97% (HPLC) Glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-histidyl-L-a-aspartyl-L-lysyl- Mouse Anti-GAL antibody Rabbit Anti-GAL antibody 88813-36-9 C146H213N43O40 多肽抗原 小鼠抗大、小鼠、鸡、猪、牛多克隆抗体 Peptides Gastrointestinal Products Galanins BioChemical Biochemicals and Reagents Amino Acids and Peptides Peptide Galanins Neuropeptides Peptides for Cell Biology