ACTH (7-38) (HUMAN)
|
|
- $130 - $1866.6
- Product name: ACTH (7-38) (HUMAN)
- CAS: 68563-24-6
- MF: C167H257N47O46
- MW: 3659.11
- EINECS:
- MDL Number:MFCD00081282
- Synonyms:acth(7-38 ;FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE;H-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-OH;CORTICOTROPIN A;CORTICOTROPIN-LIKE INTERMEDIATE PEPTIDE HUMAN (7-38);CORTICOTROPIN-INHIBITING PEPTIDE;CORTICOTROPIN-INHIBITING PEPTIDE (HUMAN);CIP (HUMAN)
12 prices
Selected condition:
Brand
- Biorbyt Ltd
- Biosynth Carbosynth
- Sigma-Aldrich
- Usbiological
Package
- 250μg
- 0.5mg
- 500ug
- 1mg
- 2mg
- 5mg
- 10mg
- ManufacturerBiorbyt Ltd
- Product numberorb364165
- Product descriptionACTH (7-38) > 95%
- Packaging1mg
- Price$588.2
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364165
- Product descriptionACTH (7-38) > 95%
- Packaging5mg
- Price$1247.8
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364165
- Product descriptionACTH (7-38) > 95%
- Packaging10mg
- Price$1866.6
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging500ug
- Price$130
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging1mg
- Price$228
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging2mg
- Price$388
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging5mg
- Price$776
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA108380
- Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
- Packaging10mg
- Price$1349.6
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberA1527
- Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
- Packaging250μg
- Price$219.67
- Updated2025-07-31
- Buy
- ManufacturerSigma-Aldrich
- Product numberA1527
- Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
- Packaging0.5mg
- Price$374
- Updated2025-07-31
- Buy
- ManufacturerSigma-Aldrich
- Product numberA1527
- Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
- Packaging1mg
- Price$612
- Updated2025-07-31
- Buy
- ManufacturerUsbiological
- Product numberC7903-80F
- Product descriptionCorticotropin Inhibiting Peptide
- Packaging1mg
- Price$262
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Biorbyt Ltd | orb364165 | ACTH (7-38) > 95% | 1mg | $588.2 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364165 | ACTH (7-38) > 95% | 5mg | $1247.8 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364165 | ACTH (7-38) > 95% | 10mg | $1866.6 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 500ug | $130 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 1mg | $228 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 2mg | $388 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 5mg | $776 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FA108380 | ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | 10mg | $1349.6 | 2021-12-16 | Buy |
| Sigma-Aldrich | A1527 | Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) | 250μg | $219.67 | 2025-07-31 | Buy |
| Sigma-Aldrich | A1527 | Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) | 0.5mg | $374 | 2025-07-31 | Buy |
| Sigma-Aldrich | A1527 | Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) | 1mg | $612 | 2025-07-31 | Buy |
| Usbiological | C7903-80F | Corticotropin Inhibiting Peptide | 1mg | $262 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :Solid
color :White to off-white
Sequence :H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
form :Solid
color :White to off-white
Sequence :H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Related product price
- Tosylmethyl isocyanide
$5-975 - TERT-BUTYL ISOCYANIDE
$22.4-550 - BENZYL ISOCYANIDE
$81.65-2194.5




