CALCITONIN, HUMAN
![]() |
- $55 - $1440
- Product name: CALCITONIN, HUMAN
- CAS: 21215-62-3
- MF: C151H226N40O45S3
- MW: 3417.85
- EINECS:244-276-2
- MDL Number:MFCD00167520
- Synonyms:calcitonin M;THYROCALCITONIN HUMAN;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 (DISULFIDE BRIDGE: 1-7);CYST-GLY-ASN-LEU-SER-THR-CYST-MET-LEU-GLY-THR-TYR-THR-GLN-AS-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO NH2;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 HUMAN;CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (DISULFIDE BRIDGE: 1-7)
16 prices
Selected condition:
Brand
- Alfa Aesar
- Biosynth Carbosynth
- ChemScene
- Sigma-Aldrich
- Tocris
Package
- 100ug
- 250ug
- 500ug
- 0.5mg
- 1mg
- 2mg
- 5mg
- 10mg
- 500U
- ManufacturerAlfa Aesar
- Product numberJ63192
- Product descriptionCalcitonin, human, 97+%
- Packaging0.5mg
- Price$282
- Updated2023-06-20
- Buy
- ManufacturerAlfa Aesar
- Product numberJ63192
- Product descriptionCalcitonin, human, 97+%
- Packaging1mg
- Price$385
- Updated2023-06-20
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging100ug
- Price$55
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging250ug
- Price$110
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging500ug
- Price$120
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging500ug
- Price$190
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging1mg
- Price$210
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging1mg
- Price$330
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging2mg
- Price$365
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging2mg
- Price$561
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging5mg
- Price$730
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging10mg
- Price$1269.6
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-0121007
- Product descriptionCalcitonin human 96.06%
- Packaging1mg
- Price$200
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-0121007
- Product descriptionCalcitonin human 96.06%
- Packaging5mg
- Price$550
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberT3535
- Product descriptionCalcitonin human ≥97% (HPLC), powder
- Packaging1mg
- Price$1440
- Updated2024-03-01
- Buy
- ManufacturerTocris
- Product number6031
- Product descriptionCalcitonin human
- Packaging500U
- Price$268
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J63192 | Calcitonin, human, 97+% | 0.5mg | $282 | 2023-06-20 | Buy |
Alfa Aesar | J63192 | Calcitonin, human, 97+% | 1mg | $385 | 2023-06-20 | Buy |
Biosynth Carbosynth | FC73302 | Calcitonin, human | 100ug | $55 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73302 | Calcitonin, human | 250ug | $110 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 500ug | $120 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73302 | Calcitonin, human | 500ug | $190 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 1mg | $210 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73302 | Calcitonin, human | 1mg | $330 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 2mg | $365 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73302 | Calcitonin, human | 2mg | $561 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 5mg | $730 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 10mg | $1269.6 | 2021-12-16 | Buy |
ChemScene | CS-0121007 | Calcitonin human 96.06% | 1mg | $200 | 2021-12-16 | Buy |
ChemScene | CS-0121007 | Calcitonin human 96.06% | 5mg | $550 | 2021-12-16 | Buy |
Sigma-Aldrich | T3535 | Calcitonin human ≥97% (HPLC), powder | 1mg | $1440 | 2024-03-01 | Buy |
Tocris | 6031 | Calcitonin human | 500U | $268 | 2021-12-16 | Buy |
Properties
Boiling point :3061.8±65.0 °C(Predicted)
Density :1.326±0.06 g/cm3(Predicted)
RTECS :XP3560000
storage temp. :−20°C
solubility :Soluble in DMSO
form :powder
color :White to off-white
biological source :synthetic (organic)
Water Solubility :Soluble to 2 mg/ml in water
Merck :13,1642
Sequence :Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7)
Density :1.326±0.06 g/cm3(Predicted)
RTECS :XP3560000
storage temp. :−20°C
solubility :Soluble in DMSO
form :powder
color :White to off-white
biological source :synthetic (organic)
Water Solubility :Soluble to 2 mg/ml in water
Merck :13,1642
Sequence :Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7)
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. A carrier peptide that can be used to internalize fusion proteinsRelated product price
- CALCITONIN (PORCINE)
$130-1347.8 - CALCITONIN, RAT
$55-1347.8 - ALPHA-CGRP (RAT)
$165-864.7
Suppliers and manufacturers
Shenzhen Nexconn Pharmatechs Ltd
Hubei Jusheng Technology Co.,Ltd.
BOC Sciences
Cellmano Biotech Limited
Hubei Ipure Biology Co., Ltd
HONG KONG IPURE BIOLOGY CO.,LIMITED
Dideu Industries Group Limited
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech