CALCITONIN, RAT
|
- $55 - $1515.6
- Product name: CALCITONIN, RAT
- CAS: 11118-25-5
- MF: C148H228N40O46S3
- MW: 3399.83
- EINECS:
- MDL Number:MFCD00133857
- Synonyms:H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2 (DISULFIDE BRIDGE: 1-7);CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2 RAT;CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (DISULFIDE BRIDGE: 1-7);CALCITONIN, RAT;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR- GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE- GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7);Calcitoninrat,Calcitoninra;Calcitonin (rat) (9CI)
22 prices
Selected condition:
Brand
- aablocks
- American Custom Chemicals Corporation
- Biosynth
- ChemScene
Package
- 100ug
- 250ug
- 0.5MG
- 500ug
- 1mg
- 2mg
- 5mg
- 10mg
- 25mg
- Manufactureraablocks
- Product numberAA008RPI
- Product descriptionCalcitonin, Rat >98%
- Packaging5mg
- Price$285
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA008RPI
- Product descriptionCalcitonin, Rat >98%
- Packaging10mg
- Price$435
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA008RPI
- Product descriptionCalcitonin, Rat >98%
- Packaging25mg
- Price$869
- Updated2026-05-28
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0000912
- Product descriptionCALCITONIN, RAT 95.00%
- Packaging0.5MG
- Price$776.16
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberVAC-00006
- Product descriptionCalcitonin, rat
- Packaging1mg
- Price$404.16
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberVAC-00006
- Product descriptionCalcitonin, rat
- Packaging5mg
- Price$909.4
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberFC108869
- Product descriptionCalcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond)
- Packaging10mg
- Price$1347.8
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberVAC-00006
- Product descriptionCalcitonin, rat
- Packaging10mg
- Price$1515.6
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberCRB1001442
- Product descriptionCalcitonin, Rat
- Packaging1mg
- Price$453.57
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging2mg
- Price$561
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC108869
- Product descriptionCalcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond)
- Packaging5mg
- Price$775
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging1mg
- Price$330
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberCRB1001442
- Product descriptionCalcitonin, Rat
- Packaging0.5mg
- Price$331.46
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC108869
- Product descriptionCalcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond)
- Packaging2mg
- Price$388
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging100ug
- Price$55
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging250ug
- Price$110
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA008RPI | Calcitonin, Rat >98% | 5mg | $285 | 2026-05-28 | Buy |
| aablocks | AA008RPI | Calcitonin, Rat >98% | 10mg | $435 | 2026-05-28 | Buy |
| aablocks | AA008RPI | Calcitonin, Rat >98% | 25mg | $869 | 2026-05-28 | Buy |
| American Custom Chemicals Corporation | PEP0000912 | CALCITONIN, RAT 95.00% | 0.5MG | $776.16 | 2021-12-16 | Buy |
| Biosynth | VAC-00006 | Calcitonin, rat | 1mg | $404.16 | 2026-06-05 | Buy |
| Biosynth | VAC-00006 | Calcitonin, rat | 5mg | $909.4 | 2026-06-05 | Buy |
| Biosynth | FC108869 | Calcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond) | 10mg | $1347.8 | 2021-12-16 | Buy |
| Biosynth | VAC-00006 | Calcitonin, rat | 10mg | $1515.6 | 2026-06-05 | Buy |
| Biosynth | CRB1001442 | Calcitonin, Rat | 1mg | $453.57 | 2026-06-04 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 2mg | $561 | 2021-12-16 | Buy |
| Biosynth | FC108869 | Calcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond) | 5mg | $775 | 2021-12-16 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 1mg | $330 | 2021-12-16 | Buy |
| Biosynth | CRB1001442 | Calcitonin, Rat | 0.5mg | $331.46 | 2026-06-04 | Buy |
| Biosynth | FC108869 | Calcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond) | 2mg | $388 | 2021-12-16 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 100ug | $55 | 2021-12-16 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 250ug | $110 | 2021-12-16 | Buy |
Properties
Boiling point :3055.0±65.0 °C(Predicted)
Density :1.325±0.06 g/cm3(Predicted)
storage temp. :−20°C
form :powder
color :White to off-white
Sequence :Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Density :1.325±0.06 g/cm3(Predicted)
storage temp. :−20°C
form :powder
color :White to off-white
Sequence :Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
More related product prices
Calcitonin salmon Elcatonin ALPHA-CGRP (RAT) CALCITONIN (PORCINE) CALCITONIN, HUMAN ALPHA-CGRP (8-37) (HUMAN)Related product price
-
Calcitonin
$403-2563.6 -
Calcitonin salmon
$79-4090 -
Elcatonin
$159-1831
Suppliers and manufacturers
GL Biochem (Shanghai) Ltd
Shanghai Hanhong Scientific Co.,Ltd.
Chemsky (shanghai) International Co.,Ltd
Cellmano Biotech Limited
Wuxi Zhongkun Biochemical Technology Co., Ltd.
Creative Peptides
Shanghai Xilong Biochemical Technology Co., Ltd.
Nanjing Leon Biological Technology Co., Ltd.
Nanjing Peptide Biotech Ltd.
Chengdu Youngshe Chemical Co., Ltd.




