CALCITONIN, RAT
|
- $55 - $1515.6
- Product name: CALCITONIN, RAT
- CAS: 11118-25-5
- MF: C148H228N40O46S3
- MW: 3399.83
- EINECS:
- MDL Number:MFCD00133857
- Synonyms:H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2 (DISULFIDE BRIDGE: 1-7);CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2 RAT;CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (DISULFIDE BRIDGE: 1-7);CALCITONIN, RAT;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR- GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE- GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7);Calcitoninrat,Calcitoninra;Calcitonin (rat) (9CI)
22 prices
Selected condition:
Brand
- aablocks
- American Custom Chemicals Corporation
- Biosynth
- ChemScene
Package
- 100ug
- 250ug
- 0.5MG
- 500ug
- 1mg
- 2mg
- 5mg
- 10mg
- 25mg
- Manufactureraablocks
- Product numberAA008RPI
- Product descriptionCalcitonin, Rat >98%
- Packaging5mg
- Price$285
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA008RPI
- Product descriptionCalcitonin, Rat >98%
- Packaging10mg
- Price$435
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA008RPI
- Product descriptionCalcitonin, Rat >98%
- Packaging25mg
- Price$869
- Updated2026-05-28
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0000912
- Product descriptionCALCITONIN, RAT 95.00%
- Packaging0.5MG
- Price$776.16
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC108869
- Product descriptionCalcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond)
- Packaging5mg
- Price$775
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC108869
- Product descriptionCalcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond)
- Packaging10mg
- Price$1347.8
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging2mg
- Price$561
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberVAC-00006
- Product descriptionCalcitonin, rat
- Packaging5mg
- Price$909.4
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberVAC-00006
- Product descriptionCalcitonin, rat
- Packaging10mg
- Price$1515.6
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberCRB1001442
- Product descriptionCalcitonin, Rat
- Packaging1mg
- Price$453.57
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberVAC-00006
- Product descriptionCalcitonin, rat
- Packaging1mg
- Price$404.16
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberCRB1001442
- Product descriptionCalcitonin, Rat
- Packaging0.5mg
- Price$331.46
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging100ug
- Price$55
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging250ug
- Price$110
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC108869
- Product descriptionCalcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond)
- Packaging500ug
- Price$130
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC73305
- Product descriptionCalcitonin, rat
- Packaging500ug
- Price$190
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA008RPI | Calcitonin, Rat >98% | 5mg | $285 | 2026-05-28 | Buy |
| aablocks | AA008RPI | Calcitonin, Rat >98% | 10mg | $435 | 2026-05-28 | Buy |
| aablocks | AA008RPI | Calcitonin, Rat >98% | 25mg | $869 | 2026-05-28 | Buy |
| American Custom Chemicals Corporation | PEP0000912 | CALCITONIN, RAT 95.00% | 0.5MG | $776.16 | 2021-12-16 | Buy |
| Biosynth | FC108869 | Calcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond) | 5mg | $775 | 2021-12-16 | Buy |
| Biosynth | FC108869 | Calcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond) | 10mg | $1347.8 | 2021-12-16 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 2mg | $561 | 2021-12-16 | Buy |
| Biosynth | VAC-00006 | Calcitonin, rat | 5mg | $909.4 | 2026-06-05 | Buy |
| Biosynth | VAC-00006 | Calcitonin, rat | 10mg | $1515.6 | 2026-06-05 | Buy |
| Biosynth | CRB1001442 | Calcitonin, Rat | 1mg | $453.57 | 2026-06-04 | Buy |
| Biosynth | VAC-00006 | Calcitonin, rat | 1mg | $404.16 | 2026-06-05 | Buy |
| Biosynth | CRB1001442 | Calcitonin, Rat | 0.5mg | $331.46 | 2026-06-04 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 100ug | $55 | 2021-12-16 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 250ug | $110 | 2021-12-16 | Buy |
| Biosynth | FC108869 | Calcitonin (rat) H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bond) | 500ug | $130 | 2021-12-16 | Buy |
| Biosynth | FC73305 | Calcitonin, rat | 500ug | $190 | 2021-12-16 | Buy |
Properties
Boiling point :3055.0±65.0 °C(Predicted)
Density :1.325±0.06 g/cm3(Predicted)
storage temp. :−20°C
form :powder
color :White to off-white
Sequence :Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Density :1.325±0.06 g/cm3(Predicted)
storage temp. :−20°C
form :powder
color :White to off-white
Sequence :Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
More related product prices
Calcitonin salmon Elcatonin ALPHA-CGRP (RAT) CALCITONIN (PORCINE) ALPHA-CGRP (8-37) (HUMAN) CALCITONIN, HUMANRelated product price
-
Calcitonin
$403-2563.6 -
Calcitonin salmon
$79-4090 -
Elcatonin
$159-1831




