MMP-2/MMP-9 Inhibitor III (trifluoroacetate salt)
|
|
- $236
- Product name: MMP-2/MMP-9 Inhibitor III (trifluoroacetate salt)
- CAS:
- MF:
- MW: 0
- EINECS:
- MDL Number:
- Synonyms:MMP-2/MMP-9 Inhibitor III (trifluoroacetate salt)
1 prices
Selected condition：
Brand
- Cayman Chemical
Package
- 1mg
- ManufacturerCayman Chemical
- Product number24697
- Product descriptionMMP-2/MMP-9 Inhibitor III (trifluoroacetate salt) ≥95%
- Packaging1mg
- Price$236
- Updated2026-04-30
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Cayman Chemical | 24697 | MMP-2/MMP-9 Inhibitor III (trifluoroacetate salt) ≥95% | 1mg | $236 | 2026-04-30 | Buy |
Properties
solubility :Water: 1 mg/ml
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
MMP-2/MMP-9 inhibitor III is a cyclic peptide inhibitor of matrix metalloproteinase-2 (MMP-2) and MMP-9 (IC50s = 10-20 μM for both).1 It is selective for MMP-2 and MMP-9 over MT1-MMP, MMP-8, and MMP-13 as well as the serine proteases trypsin-2, neutrophil elastase, and cathepsin G when used at a concentration of 500 μM. MMP-2/MMP-9 inhibitor III reduces migration of HT1080 fibrosarcoma, C8161 melanoma, SKOV3 ovarian carcinoma, and KS1767 Kaposi's sarcoma cells in vitro. Pretreatment with MMP-2/MMP-9 inhibitor III delays tumor formation in an MDA-MB-435 mouse xenograft model. MMP-2/MMP-9 inhibitor III (100-200 μg per animal) also prevents growth of established tumors in MDA-MB-435 and KS1767 mouse xenograft models.WARNING This product is not for human or veterinary use.More related product prices
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT