Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> Calcitonin eel

Calcitonin eel

Calcitonin eel price.
  • $65 - $2087.3
  • Product name: Calcitonin eel
  • CAS: 57014-02-5
  • MF: C146H241N43O47S2
  • MW: 3414.91
  • EINECS:232-693-2
  • MDL Number:MFCD00133858
  • Synonyms:CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];Thyrocalcitonin Eel, Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7];ASU 1-7
Price21 Properties Safety Information Description
21 prices
Selected condition：
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • Biosynth
  • Cayman Chemical
Package
  • 100ug
  • 250ug
  • 500ug
  • 1mg
  • 2MG
  • 5MG
  • 10mg
  • Manufactureraablocks
  • Product numberAA00E8LS
  • Product descriptionCalcitonin ≥95%
  • Packaging1mg
  • Price$202
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA00E8LS
  • Product descriptionCalcitonin ≥97%(HPLC)
  • Packaging10mg
  • Price$1877
  • Updated2026-05-28
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0000908
  • Product descriptionCALCITONIN, EEL 95.00%
  • Packaging5MG
  • Price$981.59
  • Updated2021-12-16
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0000908
  • Product descriptionCALCITONIN, EEL 95.00%
  • Packaging1MG
  • Price$676.11
  • Updated2021-12-16
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0000908
  • Product descriptionCALCITONIN, EEL 95.00%
  • Packaging2MG
  • Price$730.88
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC73303
  • Product descriptionCalcitonin, eel
  • Packaging5mg
  • Price$890
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC42995
  • Product descriptionCalcitonin eel
  • Packaging2mg
  • Price$684
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00292
  • Product descriptionCalcitonin, eel
  • Packaging10mg
  • Price$2087.3
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberFC42995
  • Product descriptionCalcitonin eel
  • Packaging500ug
  • Price$225
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC73303
  • Product descriptionCalcitonin, eel
  • Packaging1mg
  • Price$262
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC42995
  • Product descriptionCalcitonin eel
  • Packaging1mg
  • Price$393
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberVAC-00292
  • Product descriptionCalcitonin, eel
  • Packaging1mg
  • Price$417.45
  • Updated2026-06-05
  • Buy
  • ManufacturerBiosynth
  • Product numberFC73303
  • Product descriptionCalcitonin, eel
  • Packaging2mg
  • Price$445
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC42995
  • Product descriptionCalcitonin eel
  • Packaging100ug
  • Price$65
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC73303
  • Product descriptionCalcitonin, eel
  • Packaging250ug
  • Price$87.5
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFC42995
  • Product descriptionCalcitonin eel
  • Packaging250ug
  • Price$130
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA00E8LS Calcitonin ≥95% 1mg $202 2026-05-28 Buy
aablocks AA00E8LS Calcitonin ≥97%(HPLC) 10mg $1877 2026-05-28 Buy
American Custom Chemicals Corporation PEP0000908 CALCITONIN, EEL 95.00% 5MG $981.59 2021-12-16 Buy
American Custom Chemicals Corporation PEP0000908 CALCITONIN, EEL 95.00% 1MG $676.11 2021-12-16 Buy
American Custom Chemicals Corporation PEP0000908 CALCITONIN, EEL 95.00% 2MG $730.88 2021-12-16 Buy
Biosynth FC73303 Calcitonin, eel 5mg $890 2021-12-16 Buy
Biosynth FC42995 Calcitonin eel 2mg $684 2021-12-16 Buy
Biosynth VAC-00292 Calcitonin, eel 10mg $2087.3 2026-06-05 Buy
Biosynth FC42995 Calcitonin eel 500ug $225 2021-12-16 Buy
Biosynth FC73303 Calcitonin, eel 1mg $262 2021-12-16 Buy
Biosynth FC42995 Calcitonin eel 1mg $393 2021-12-16 Buy
Biosynth VAC-00292 Calcitonin, eel 1mg $417.45 2026-06-05 Buy
Biosynth FC73303 Calcitonin, eel 2mg $445 2021-12-16 Buy
Biosynth FC42995 Calcitonin eel 100ug $65 2021-12-16 Buy
Biosynth FC73303 Calcitonin, eel 250ug $87.5 2021-12-16 Buy
Biosynth FC42995 Calcitonin eel 250ug $130 2021-12-16 Buy
Next Last

Properties

Density :1.52±0.1 g/cm3(Predicted)
storage temp. :−20°C
solubility :Water: 10 mg/ml
form :A solid
Sequence :Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Calcitonin eel is a peptide hormone that lowers calcium concentration in the blood. In humans, it is released by thyroid cells and acts to decrease the formation and absorptive activity of osteoclasts. Its role in regulating plasma calcium is much greater in children and in certain diseases than in normal adults. Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.

More related product prices

Calcitonin salmon Oxytocin Pralmorelin Goserelin acetate Hexarelin Octreotide acetate Gonadorelin acetate Angiotensin acetate Lypressin Pramlintide acetate Glucagon

Related product price

Suppliers and manufacturers

Chembest Research Laboratories Limited GL Biochem (Shanghai) Ltd Shanghai Hanhong Scientific Co.,Ltd. Chemsky (shanghai) International Co.,Ltd Cellmano Biotech Limited Beijing HuaMeiHuLiBiological Chemical Shanghai Aladdin Bio-Chem Technology Co.,LTD TargetMol Chemicals Inc. Wuxi Zhongkun Biochemical Technology Co., Ltd. Chizhou Kailong Import and Export Trade Co., Ltd.