Calcitonin eel
|
- $65 - $981.59
- Product name: Calcitonin eel
- CAS: 57014-02-5
- MF: C146H241N43O47S2
- MW: 3414.91
- EINECS:232-693-2
- MDL Number:MFCD00133858
- Synonyms:THYROCALCITONIN EEL;CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
13 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- Biosynth Carbosynth
Package
- 100ug
- 250ug
- 500ug
- 1MG
- 2MG
- 5MG
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0000908
- Product descriptionCALCITONIN, EEL 95.00%
- Packaging5MG
- Price$981.59
- Updated2021-12-16
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0000908
- Product descriptionCALCITONIN, EEL 95.00%
- Packaging2MG
- Price$730.88
- Updated2021-12-16
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0000908
- Product descriptionCALCITONIN, EEL 95.00%
- Packaging1MG
- Price$676.11
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC42995
- Product descriptionCalcitonin eel
- Packaging100ug
- Price$65
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73303
- Product descriptionCalcitonin, eel
- Packaging250ug
- Price$87.5
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC42995
- Product descriptionCalcitonin eel
- Packaging250ug
- Price$130
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73303
- Product descriptionCalcitonin, eel
- Packaging500ug
- Price$150
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC42995
- Product descriptionCalcitonin eel
- Packaging500ug
- Price$225
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73303
- Product descriptionCalcitonin, eel
- Packaging1mg
- Price$262
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC42995
- Product descriptionCalcitonin eel
- Packaging1mg
- Price$393
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73303
- Product descriptionCalcitonin, eel
- Packaging2mg
- Price$445
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC42995
- Product descriptionCalcitonin eel
- Packaging2mg
- Price$684
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73303
- Product descriptionCalcitonin, eel
- Packaging5mg
- Price$890
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| American Custom Chemicals Corporation | PEP0000908 | CALCITONIN, EEL 95.00% | 5MG | $981.59 | 2021-12-16 | Buy |
| American Custom Chemicals Corporation | PEP0000908 | CALCITONIN, EEL 95.00% | 2MG | $730.88 | 2021-12-16 | Buy |
| American Custom Chemicals Corporation | PEP0000908 | CALCITONIN, EEL 95.00% | 1MG | $676.11 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC42995 | Calcitonin eel | 100ug | $65 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73303 | Calcitonin, eel | 250ug | $87.5 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC42995 | Calcitonin eel | 250ug | $130 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73303 | Calcitonin, eel | 500ug | $150 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC42995 | Calcitonin eel | 500ug | $225 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73303 | Calcitonin, eel | 1mg | $262 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC42995 | Calcitonin eel | 1mg | $393 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73303 | Calcitonin, eel | 2mg | $445 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC42995 | Calcitonin eel | 2mg | $684 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73303 | Calcitonin, eel | 5mg | $890 | 2021-12-16 | Buy |
Properties
Density :1.52±0.1 g/cm3(Predicted)
storage temp. :−20°C
solubility :Water: 10 mg/ml
form :A solid
Sequence :Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
storage temp. :−20°C
solubility :Water: 10 mg/ml
form :A solid
Sequence :Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Calcitonin eel is a peptide hormone that lowers calcium concentration in the blood. In humans, it is released by thyroid cells and acts to decrease the formation and absorptive activity of osteoclasts. Its role in regulating plasma calcium is much greater in children and in certain diseases than in normal adults. Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.Related product price
- Calcitonin salmon
$120-3810 - Elcatonin
$159-782.23 - Calcitonin
$531-2563.6




