GALANIN, RAT
|
- $235 - $681.45
- Product name: GALANIN, RAT
- CAS: 114547-31-8
- MF: C141H211N43O41
- MW: 3164.45
- EINECS:
- MDL Number:MFCD00133354
- Synonyms:GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;GALANIN, RAT;Galanin (mouse, rat);GALANIN RATGALANIN;Rat galanin-(1-29);L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-a-aspa
5 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- ApexBio Technology
- Thermo Scientific Chemicals
- Tocris
Package
- 1
- 0.5MG
- 1mg
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0001402
- Product descriptionGALANIN 95.00%
- Packaging0.5MG
- Price$681.45
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5325
- Product descriptionGalanin(1-29)(rat,mouse)
- Packaging1mg
- Price$345
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5325
- Product descriptionGalanin (1-29) (rat, mouse)
- Packaging1mg
- Price$456
- Updated2026-05-06
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ66734
- Product descriptionGalanin, rat
- Packaging1mg
- Price$274
- Updated2021-12-16
- Buy
- ManufacturerTocris
- Product number2696
- Product descriptionGalanin(1-29)(rat,mouse)
- Packaging1
- Price$235
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| American Custom Chemicals Corporation | PEP0001402 | GALANIN 95.00% | 0.5MG | $681.45 | 2021-12-16 | Buy |
| ApexBio Technology | B5325 | Galanin(1-29)(rat,mouse) | 1mg | $345 | 2021-12-16 | Buy |
| ApexBio Technology | B5325 | Galanin (1-29) (rat, mouse) | 1mg | $456 | 2026-05-06 | Buy |
| Thermo Scientific Chemicals | J66734 | Galanin, rat | 1mg | $274 | 2021-12-16 | Buy |
| Tocris | 2696 | Galanin(1-29)(rat,mouse) | 1 | $235 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :powder
color :White
Water Solubility :Soluble to 1 mg/ml in water
Sequence :Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
form :powder
color :White
Water Solubility :Soluble to 1 mg/ml in water
Sequence :Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
More related product prices
FenpropidinRelated product price
- Fenpropidin
$54-171 - GALANIN, RAT
$235-681.45 - 367518-31-8
$79.9-774.95




