Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> GALANIN, RAT

GALANIN, RAT

GALANIN, RAT price.
  • $226.79 - $3400
  • Product name: GALANIN, RAT
  • CAS: 114547-31-8
  • MF: C141H211N43O41
  • MW: 3164.45
  • EINECS:
  • MDL Number:MFCD00133354
  • Synonyms:GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;GALANIN, RAT;Galanin (mouse, rat);GALANIN RATGALANIN;Rat galanin-(1-29);L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-a-aspa
Price13 Properties Safety Information Description
13 prices
Selected condition：
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Biosynth
  • Thermo Scientific Chemicals
  • Tocris
Package
  • 250ug
  • 1
  • 500ug
  • 0.5MG
  • 1000ug
  • 1mg
  • 2000ug
  • 5000ug
  • Manufactureraablocks
  • Product numberAA008RPR
  • Product descriptionGalanin, Rat >95%
  • Packaging1mg
  • Price$324
  • Updated2026-05-28
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0001402
  • Product descriptionGALANIN 95.00%
  • Packaging0.5MG
  • Price$681.45
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5325
  • Product descriptionGalanin (1-29) (rat, mouse)
  • Packaging1mg
  • Price$456
  • Updated2026-05-06
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging250ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging500ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging1000ug
  • Price$920
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberPGA-4244-V
  • Product descriptionGalanin (Rat)
  • Packaging0.5mg
  • Price$1485.77
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging2000ug
  • Price$1580
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging5000ug
  • Price$3400
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberCRB1000482
  • Product descriptionGalanin Mouse, Rat
  • Packaging1mg
  • Price$331.46
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberCRB1000482
  • Product descriptionGalanin Mouse, Rat
  • Packaging0.5mg
  • Price$226.79
  • Updated2026-06-04
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ66734
  • Product descriptionGalanin, rat
  • Packaging1mg
  • Price$274
  • Updated2021-12-16
  • Buy
  • ManufacturerTocris
  • Product number2696
  • Product descriptionGalanin(1-29)(rat,mouse)
  • Packaging1
  • Price$235
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA008RPR Galanin, Rat >95% 1mg $324 2026-05-28 Buy
American Custom Chemicals Corporation PEP0001402 GALANIN 95.00% 0.5MG $681.45 2021-12-16 Buy
ApexBio Technology B5325 Galanin (1-29) (rat, mouse) 1mg $456 2026-05-06 Buy
Biosynth FG110108 Galanin (mouse, rat) 250ug $900 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 500ug $900 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 1000ug $920 2026-06-04 Buy
Biosynth PGA-4244-V Galanin (Rat) 0.5mg $1485.77 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 2000ug $1580 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 5000ug $3400 2026-06-04 Buy
Biosynth CRB1000482 Galanin Mouse, Rat 1mg $331.46 2026-06-04 Buy
Biosynth CRB1000482 Galanin Mouse, Rat 0.5mg $226.79 2026-06-04 Buy
Thermo Scientific Chemicals J66734 Galanin, rat 1mg $274 2021-12-16 Buy
Tocris 2696 Galanin(1-29)(rat,mouse) 1 $235 2021-12-16 Buy

Properties

Density :1.522±0.14 g/cm3(Temp: 25 °C; Press: 760 Torr)(predicted)
storage temp. :−20°C
form :powder
color :White
Water Solubility :Soluble to 1 mg/ml in water
Sequence :Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

More related product prices

Fenpropidin

Related product price

Suppliers and manufacturers

3B Pharmachem (Wuhan) International Co.,Ltd. GL Biochem (Shanghai) Ltd Shanghai Hanhong Scientific Co.,Ltd. Chemsky（shanghai）International Co.,Ltd. Cellmano Biotech Limited TargetMol Chemicals Inc. Wuxi Zhongkun Biochemical Technology Co., Ltd. Creative Peptides Shanghai Xilong Biochemical Technology Co., Ltd. Nanjing Leon Biological Technology Co., Ltd.