Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> GALANIN, RAT

GALANIN, RAT

GALANIN, RAT price.
  • $226.79 - $3400
  • Product name: GALANIN, RAT
  • CAS: 114547-31-8
  • MF: C141H211N43O41
  • MW: 3164.45
  • EINECS:
  • MDL Number:MFCD00133354
  • Synonyms:GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2;GALANIN, RAT;Galanin (mouse, rat);GALANIN RATGALANIN;Rat galanin-(1-29);L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-a-aspa
14 prices
Selected condition:
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Biosynth
  • Thermo Scientific Chemicals
  • Tocris
Package
  • 250ug
  • 1
  • 500ug
  • 0.5MG
  • 1000ug
  • 1mg
  • 2000ug
  • 5000ug
  • Manufactureraablocks
  • Product numberAA008RPR
  • Product descriptionGalanin, Rat >95%
  • Packaging1mg
  • Price$324
  • Updated2026-05-28
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0001402
  • Product descriptionGALANIN 95.00%
  • Packaging0.5MG
  • Price$681.45
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5325
  • Product descriptionGalanin(1-29)(rat,mouse)
  • Packaging1mg
  • Price$345
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5325
  • Product descriptionGalanin (1-29) (rat, mouse)
  • Packaging1mg
  • Price$456
  • Updated2026-05-06
  • Buy
  • ManufacturerBiosynth
  • Product numberCRB1000482
  • Product descriptionGalanin Mouse, Rat
  • Packaging1mg
  • Price$331.46
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging250ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging500ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging1000ug
  • Price$920
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberPGA-4244-V
  • Product descriptionGalanin (Rat)
  • Packaging0.5mg
  • Price$1485.77
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging2000ug
  • Price$1580
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG110108
  • Product descriptionGalanin (mouse, rat)
  • Packaging5000ug
  • Price$3400
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberCRB1000482
  • Product descriptionGalanin Mouse, Rat
  • Packaging0.5mg
  • Price$226.79
  • Updated2026-06-04
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ66734
  • Product descriptionGalanin, rat
  • Packaging1mg
  • Price$274
  • Updated2021-12-16
  • Buy
  • ManufacturerTocris
  • Product number2696
  • Product descriptionGalanin(1-29)(rat,mouse)
  • Packaging1
  • Price$235
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA008RPR Galanin, Rat >95% 1mg $324 2026-05-28 Buy
American Custom Chemicals Corporation PEP0001402 GALANIN 95.00% 0.5MG $681.45 2021-12-16 Buy
ApexBio Technology B5325 Galanin(1-29)(rat,mouse) 1mg $345 2021-12-16 Buy
ApexBio Technology B5325 Galanin (1-29) (rat, mouse) 1mg $456 2026-05-06 Buy
Biosynth CRB1000482 Galanin Mouse, Rat 1mg $331.46 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 250ug $900 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 500ug $900 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 1000ug $920 2026-06-04 Buy
Biosynth PGA-4244-V Galanin (Rat) 0.5mg $1485.77 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 2000ug $1580 2026-06-04 Buy
Biosynth FG110108 Galanin (mouse, rat) 5000ug $3400 2026-06-04 Buy
Biosynth CRB1000482 Galanin Mouse, Rat 0.5mg $226.79 2026-06-04 Buy
Thermo Scientific Chemicals J66734 Galanin, rat 1mg $274 2021-12-16 Buy
Tocris 2696 Galanin(1-29)(rat,mouse) 1 $235 2021-12-16 Buy

Properties

Density :1.522±0.14 g/cm3(Temp: 25 °C; Press: 760 Torr)(predicted)
storage temp. :−20°C
form :powder
color :White
Water Solubility :Soluble to 1 mg/ml in water
Sequence :Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description


More related product prices

Fenpropidin

Related product price