Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> GRF (1-43) (rat)

GRF (1-43) (rat)

GRF (1-43) (rat) price.
  • $150 - $3300
  • Product name: GRF (1-43) (rat)
  • CAS: 86472-71-1
  • MF: C225H360N76O67S
  • MW: 5233.7999
  • EINECS:
  • MDL Number:MFCD00081673
  • Synonyms:somatotropin releasing hormone (1-43);somatoliberin, rat;HIS-ALA-ASP-ALA-ILE-PHE-THR-SER-SER-TYR-ARG-ARG-ILE-LEU-GLY-GLN-LEU-TYR-ALA-ARG-LYS-LEU-LEU-HIS-GLU-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-ARG-SER-ARG-PHE-ASN;GRF (rat) SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat);SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat);Growth HorMone Releasing Factor ratGrowth HorMone Releasing;GHRF RAT;HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN
Price19 Properties Safety Information Description
19 prices
Selected condition：
Brand
  • aablocks
  • Biosynth
  • Usbiological
Package
  • 50ug
  • 100ug
  • 250ug
  • 500ug
  • 1000ug
  • 1mg
  • 2mg
  • 2000ug
  • 5000ug
  • 5mg
  • 10000ug
  • 10mg
  • Manufactureraablocks
  • Product numberAA00GRXW
  • Product descriptionGRF (1-43) (RAT)
  • Packaging1mg
  • Price$832
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA00GRXW
  • Product descriptionGRF (1-43) (RAT)
  • Packaging10mg
  • Price$2575
  • Updated2026-05-28
  • Buy
  • Manufactureraablocks
  • Product numberAA00GRXW
  • Product descriptionGRF (1-43) (RAT)
  • Packaging5mg
  • Price$1788
  • Updated2026-05-28
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging10mg
  • Price$2200
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging5000ug
  • Price$2250
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging10000ug
  • Price$3300
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109495
  • Product descriptionGHRF trifluoroacetate (rat)
  • Packaging250ug
  • Price$340
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109495
  • Product descriptionGHRF trifluoroacetate (rat)
  • Packaging100ug
  • Price$171
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109495
  • Product descriptionGHRF trifluoroacetate (rat)
  • Packaging50ug
  • Price$150
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109495
  • Product descriptionGHRF trifluoroacetate (rat)
  • Packaging1mg
  • Price$950
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging1000ug
  • Price$980
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging2mg
  • Price$1000
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging5mg
  • Price$1500
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging2000ug
  • Price$1520
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG73410
  • Product descriptionGHRF, rat
  • Packaging500ug
  • Price$560
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109495
  • Product descriptionGHRF trifluoroacetate (rat)
  • Packaging500ug
  • Price$595
  • Updated2026-06-04
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA00GRXW GRF (1-43) (RAT) 1mg $832 2026-05-28 Buy
aablocks AA00GRXW GRF (1-43) (RAT) 10mg $2575 2026-05-28 Buy
aablocks AA00GRXW GRF (1-43) (RAT) 5mg $1788 2026-05-28 Buy
Biosynth FG73410 GHRF, rat 10mg $2200 2021-12-16 Buy
Biosynth FG73410 GHRF, rat 5000ug $2250 2026-06-04 Buy
Biosynth FG73410 GHRF, rat 10000ug $3300 2026-06-04 Buy
Biosynth FG109495 GHRF trifluoroacetate (rat) 250ug $340 2026-06-04 Buy
Biosynth FG109495 GHRF trifluoroacetate (rat) 100ug $171 2026-06-04 Buy
Biosynth FG109495 GHRF trifluoroacetate (rat) 50ug $150 2026-06-04 Buy
Biosynth FG109495 GHRF trifluoroacetate (rat) 1mg $950 2021-12-16 Buy
Biosynth FG73410 GHRF, rat 1000ug $980 2026-06-04 Buy
Biosynth FG73410 GHRF, rat 2mg $1000 2021-12-16 Buy
Biosynth FG73410 GHRF, rat 5mg $1500 2021-12-16 Buy
Biosynth FG73410 GHRF, rat 2000ug $1520 2026-06-04 Buy
Biosynth FG73410 GHRF, rat 500ug $560 2026-06-04 Buy
Biosynth FG109495 GHRF trifluoroacetate (rat) 500ug $595 2026-06-04 Buy
Next Last

Properties

storage temp. :−20°C
form :powder

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

More related product prices

Ethyl isocyanoacetate Tosylmethyl isocyanide PHENYLSELENOL TERT-BUTYL ISOCYANIDE 1,1,3,3-TETRAMETHYLBUTYL ISOCYANIDE METHYL ISOCYANOACETATE N-BUTYLISOCYANIDE

Related product price

Suppliers and manufacturers

GL Biochem (Shanghai) Ltd Shanghai Hanhong Scientific Co.,Ltd. Chemsky (shanghai) International Co.,Ltd Cellmano Biotech Limited Wuxi Zhongkun Biochemical Technology Co., Ltd. Nanjing Leon Biological Technology Co., Ltd. Nanjing Peptide Biotech Ltd. Hangzhou Peptidego Biotech Co.,Ltd. Hangzhou Go Top Peptide Biotech Chengdu Peter-like Biotechnology Co., Ltd.