| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:GHRF, rat
CAS:86472-71-1
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
|
| | GRF (1-43) (RAT) Basic information |
| Product Name: | GRF (1-43) (RAT) | | Synonyms: | somatotropin releasing hormone (1-43);somatoliberin, rat;HIS-ALA-ASP-ALA-ILE-PHE-THR-SER-SER-TYR-ARG-ARG-ILE-LEU-GLY-GLN-LEU-TYR-ALA-ARG-LYS-LEU-LEU-HIS-GLU-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-ARG-SER-ARG-PHE-ASN;GRF (rat)
SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat);SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat);Growth HorMone Releasing Factor ratGrowth HorMone Releasing;GHRF RAT;HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN | | CAS: | 86472-71-1 | | MF: | C225H360N76O67S | | MW: | 5233.7999 | | EINECS: | | | Product Categories: | Peptide | | Mol File: | 86472-71-1.mol |  |
| | GRF (1-43) (RAT) Chemical Properties |
| storage temp. | −20°C | | form | powder |
| | GRF (1-43) (RAT) Usage And Synthesis |
| | GRF (1-43) (RAT) Preparation Products And Raw materials |
|