SAUVAGINE
|
|
- $334 - $2650
- Product name: SAUVAGINE
- CAS: 74434-59-6
- MF: C202H346N56O63S1
- MW: 4599.31
- EINECS:
- MDL Number:MFCD00081983
- Synonyms:M.W. 4599.31 C202H346N56O63S;H-PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;GLP-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;SAUVAGINE;SAUVAGINE (FROG);PYR-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2;PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PGLU-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2
17 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- ApexBio Technology
- Biorbyt Ltd
- Biosynth
- Cayman Chemical
- Tocris
- Usbiological
Package
- 250ug
- 500μg
- 500ug
- 0.5MG
- 1000ug
- 1mg
- 2000ug
- 5mg
- 5000ug
- 10mg
- 500U
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0011586
- Product descriptionSAUVAGINE 95.00%
- Packaging0.5MG
- Price$658.35
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5150
- Product descriptionSauvagine
- Packaging500ug
- Price$687
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB5150
- Product descriptionSauvagine
- Packaging500ug
- Price$654
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372805
- Product descriptionSauvagine (Frog) > 95%
- Packaging1mg
- Price$734.4
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372805
- Product descriptionSauvagine (Frog) > 95%
- Packaging5mg
- Price$1564
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372805
- Product descriptionSauvagine (Frog) > 95%
- Packaging10mg
- Price$2340.9
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging5000ug
- Price$2650
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging1000ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging250ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging500ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging2000ug
- Price$1220
- Updated2026-06-04
- Buy
- ManufacturerCayman Chemical
- Product number34442
- Product descriptionSauvagine (trifluoroacetate salt) ≥95%
- Packaging1mg
- Price$600
- Updated2026-04-30
- Buy
- ManufacturerCayman Chemical
- Product number34442
- Product descriptionSauvagine (trifluoroacetate salt) ≥95%
- Packaging500μg
- Price$334
- Updated2026-04-30
- Buy
- ManufacturerTocris
- Product number1609
- Product descriptionSauvagine
- Packaging500U
- Price$445
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberS0200-01
- Product descriptionSauvagine
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number256609
- Product descriptionSauvagine
- Packaging500ug
- Price$749
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| American Custom Chemicals Corporation | PEP0011586 | SAUVAGINE 95.00% | 0.5MG | $658.35 | 2021-12-16 | Buy |
| ApexBio Technology | B5150 | Sauvagine | 500ug | $687 | 2026-05-06 | Buy |
| ApexBio Technology | B5150 | Sauvagine | 500ug | $654 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372805 | Sauvagine (Frog) > 95% | 1mg | $734.4 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372805 | Sauvagine (Frog) > 95% | 5mg | $1564 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372805 | Sauvagine (Frog) > 95% | 10mg | $2340.9 | 2021-12-16 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 5000ug | $2650 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 1000ug | $900 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 250ug | $900 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 500ug | $900 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 2000ug | $1220 | 2026-06-04 | Buy |
| Cayman Chemical | 34442 | Sauvagine (trifluoroacetate salt) ≥95% | 1mg | $600 | 2026-04-30 | Buy |
| Cayman Chemical | 34442 | Sauvagine (trifluoroacetate salt) ≥95% | 500μg | $334 | 2026-04-30 | Buy |
| Tocris | 1609 | Sauvagine | 500U | $445 | 2021-12-16 | Buy |
| Usbiological | S0200-01 | Sauvagine | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | 256609 | Sauvagine | 500ug | $749 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc.
form :Powder
Sequence :{Pry}-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-Asn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2
InChIKey :ILCVKEBXPLEGOY-ZLFMSJRASA-N
solubility :Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc.
form :Powder
Sequence :{Pry}-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-Asn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2
InChIKey :ILCVKEBXPLEGOY-ZLFMSJRASA-N
Safety Information
| Symbol(GHS): |
|
|||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | |||||||||||||||||||||||||||||||||||
| Hazard statements: |
|
|||||||||||||||||||||||||||||||||||
| Precautionary statements: |
|
Description
Sauvagine is a peptide hormone, first isolated from the skin of the South American frog Phyllomedusa sauvagei, with adrenocorticotropic hormone (ACTH)-releasing activity and antidiuretic activity.Related product price
-
1,1,3,3-TETRAMETHYLBUTYL ISOCYANIDE
$26-3655 -
14096-51-6
$40-1298 -
TERT-BUTYL ISOCYANIDE
$20-634.65




