Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> SAUVAGINE

SAUVAGINE

SAUVAGINE price.
  • $445 - $2340.9
  • Product name: SAUVAGINE
  • CAS: 74434-59-6
  • MF: C202H346N56O63S1
  • MW: 4599.31
  • EINECS:
  • MDL Number:MFCD00081983
  • Synonyms:M.W. 4599.31 C202H346N56O63S;H-PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;GLP-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;SAUVAGINE;SAUVAGINE (FROG);PYR-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2;PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PGLU-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2
8 prices
Selected condition:
Brand
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Biorbyt Ltd
  • Tocris
  • Usbiological
Package
  • 500ug
  • 0.5MG
  • 1mg
  • 5mg
  • 10mg
  • 500U
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0011586
  • Product descriptionSAUVAGINE 95.00%
  • Packaging0.5MG
  • Price$658.35
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5150
  • Product descriptionSauvagine
  • Packaging500ug
  • Price$654
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372805
  • Product descriptionSauvagine (Frog) > 95%
  • Packaging1mg
  • Price$734.4
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372805
  • Product descriptionSauvagine (Frog) > 95%
  • Packaging5mg
  • Price$1564
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb372805
  • Product descriptionSauvagine (Frog) > 95%
  • Packaging10mg
  • Price$2340.9
  • Updated2021-12-16
  • Buy
  • ManufacturerTocris
  • Product number1609
  • Product descriptionSauvagine
  • Packaging500U
  • Price$445
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product numberS0200-01
  • Product descriptionSauvagine
  • Packaging1mg
  • Price$531
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number256609
  • Product descriptionSauvagine
  • Packaging500ug
  • Price$749
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
American Custom Chemicals Corporation PEP0011586 SAUVAGINE 95.00% 0.5MG $658.35 2021-12-16 Buy
ApexBio Technology B5150 Sauvagine 500ug $654 2021-12-16 Buy
Biorbyt Ltd orb372805 Sauvagine (Frog) > 95% 1mg $734.4 2021-12-16 Buy
Biorbyt Ltd orb372805 Sauvagine (Frog) > 95% 5mg $1564 2021-12-16 Buy
Biorbyt Ltd orb372805 Sauvagine (Frog) > 95% 10mg $2340.9 2021-12-16 Buy
Tocris 1609 Sauvagine 500U $445 2021-12-16 Buy
Usbiological S0200-01 Sauvagine 1mg $531 2021-12-16 Buy
Usbiological 256609 Sauvagine 500ug $749 2021-12-16 Buy

Properties

storage temp. :−20°C
solubility :Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc.
form :Powder
Sequence :{Pry}-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-Asn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Sauvagine is a peptide hormone, first isolated from the skin of the South American frog Phyllomedusa sauvagei, with adrenocorticotropic hormone (ACTH)-releasing activity and antidiuretic activity.

Related product price