SAUVAGINE
|
|
- $334 - $2650
- Product name: SAUVAGINE
- CAS: 74434-59-6
- MF: C202H346N56O63S1
- MW: 4599.31
- EINECS:
- MDL Number:MFCD00081983
- Synonyms:M.W. 4599.31 C202H346N56O63S;H-PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;GLP-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;SAUVAGINE;SAUVAGINE (FROG);PYR-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2;PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PGLU-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2
15 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- ApexBio Technology
- Biorbyt Ltd
- Biosynth
- Cayman Chemical
- Tocris
- Usbiological
Package
- 250ug
- 500μg
- 500ug
- 0.5MG
- 1000ug
- 1mg
- 2000ug
- 5mg
- 5000ug
- 10mg
- 500U
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0011586
- Product descriptionSAUVAGINE 95.00%
- Packaging0.5MG
- Price$658.35
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5150
- Product descriptionSauvagine
- Packaging500ug
- Price$687
- Updated2026-05-06
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372805
- Product descriptionSauvagine (Frog) > 95%
- Packaging1mg
- Price$734.4
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372805
- Product descriptionSauvagine (Frog) > 95%
- Packaging5mg
- Price$1564
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372805
- Product descriptionSauvagine (Frog) > 95%
- Packaging10mg
- Price$2340.9
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging5000ug
- Price$2650
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging1000ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging250ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging500ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFS109392
- Product descriptionSauvagine trifluoroacetate salt
- Packaging2000ug
- Price$1220
- Updated2026-06-04
- Buy
- ManufacturerCayman Chemical
- Product number34442
- Product descriptionSauvagine (trifluoroacetate salt) ≥95%
- Packaging500μg
- Price$334
- Updated2026-04-30
- Buy
- ManufacturerCayman Chemical
- Product number34442
- Product descriptionSauvagine (trifluoroacetate salt) ≥95%
- Packaging1mg
- Price$600
- Updated2026-04-30
- Buy
- ManufacturerTocris
- Product number1609
- Product descriptionSauvagine
- Packaging500U
- Price$445
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberS0200-01
- Product descriptionSauvagine
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number256609
- Product descriptionSauvagine Asreported
- Packaging500ug
- Price$868
- Updated2026-06-03
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| American Custom Chemicals Corporation | PEP0011586 | SAUVAGINE 95.00% | 0.5MG | $658.35 | 2021-12-16 | Buy |
| ApexBio Technology | B5150 | Sauvagine | 500ug | $687 | 2026-05-06 | Buy |
| Biorbyt Ltd | orb372805 | Sauvagine (Frog) > 95% | 1mg | $734.4 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372805 | Sauvagine (Frog) > 95% | 5mg | $1564 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372805 | Sauvagine (Frog) > 95% | 10mg | $2340.9 | 2021-12-16 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 5000ug | $2650 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 1000ug | $900 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 250ug | $900 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 500ug | $900 | 2026-06-04 | Buy |
| Biosynth | FS109392 | Sauvagine trifluoroacetate salt | 2000ug | $1220 | 2026-06-04 | Buy |
| Cayman Chemical | 34442 | Sauvagine (trifluoroacetate salt) ≥95% | 500μg | $334 | 2026-04-30 | Buy |
| Cayman Chemical | 34442 | Sauvagine (trifluoroacetate salt) ≥95% | 1mg | $600 | 2026-04-30 | Buy |
| Tocris | 1609 | Sauvagine | 500U | $445 | 2021-12-16 | Buy |
| Usbiological | S0200-01 | Sauvagine | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | 256609 | Sauvagine Asreported | 500ug | $868 | 2026-06-03 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc.
form :Powder
Sequence :{Pry}-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-Asn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2
InChIKey :ILCVKEBXPLEGOY-ZLFMSJRASA-N
solubility :Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc.
form :Powder
Sequence :{Pry}-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-Asn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2
InChIKey :ILCVKEBXPLEGOY-ZLFMSJRASA-N
Safety Information
| Symbol(GHS): |
|
|||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | |||||||||||||||||||||||||||||||||||
| Hazard statements: |
|
|||||||||||||||||||||||||||||||||||
| Precautionary statements: |
|
Description
Sauvagine is a peptide hormone, first isolated from the skin of the South American frog Phyllomedusa sauvagei, with adrenocorticotropic hormone (ACTH)-releasing activity and antidiuretic activity.Related product price
-
Cupric acetylacetonate
$6-4747 -
COBALT(II) ACETYLACETONATE
$43-1161 -
Tosylmethyl isocyanide
$5-1298
Suppliers and manufacturers
3B Pharmachem (Wuhan) International Co.,Ltd.
GL Biochem (Shanghai) Ltd
Shanghai Hanhong Scientific Co.,Ltd.
Chemsky(shanghai)International Co.,Ltd.
Hunan Hui Bai Shi Biotechnology Co., Ltd.
Cellmano Biotech Limited
Wuxi Zhongkun Biochemical Technology Co., Ltd.
Creative Peptides
Nanjing Leon Biological Technology Co., Ltd.
Nanjing Peptide Biotech Ltd.




