| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:b-Endorphin: 6-31, human
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
| Company Name: |
Nanjing Peptide Biotech Ltd.
|
| Tel: |
025-58361106-805 13082558573 |
| Email: |
liugang@njpeptide.com |
| Products Intro: |
Product Name:b-Endorphin: 6-31, human
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
|
| Company Name: |
Hangzhou Sinoda Pharmaceutical Technology Co. LTD
|
| Tel: |
17306812703 |
| Email: |
3007955328@qq.com |
| Products Intro: |
Product Name:β-Endorphin: 6-31, human
Purity:95% or 98% Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement.
|
| Company Name: |
Shanghai Toyang Biotechnology Co., LTD
|
| Tel: |
021-59555769 13524932310 |
| Email: |
1405894150@qq.com |
| Products Intro: |
Product Name:β-Endorphin (6-31) (human)
Purity:>95% Package:5mg，10mg，50mg，100mg，500mg，1g
|
|
| | b-Endorphin (6-31), human Basic information |
| Product Name: | b-Endorphin (6-31), human | | Synonyms: | b-Endorphin (6-31), human;THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-ALA-TYR-LYS-LYS-GLY-GLU;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-VAL-HIS-LYS-LYS-GLY-GLN: YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ;β-Endorphin: 6-31, human | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![b-Endorphin (6-31), human Structure]() |
| | b-Endorphin (6-31), human Chemical Properties |
| | b-Endorphin (6-31), human Usage And Synthesis |
| | b-Endorphin (6-31), human Preparation Products And Raw materials |
|