Company Name: |
GL Biochem (Shanghai) Ltd
|
Tel: |
21-61263452 13641803416 |
Email: |
ymbetter@glbiochem.com |
Products Intro: |
Product Name:β-Endorphin, porcine;YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
|
Company Name: |
Nanjing Peptide Biotech Ltd.
|
Tel: |
025-025-58361106-805-805 13082558573 |
Email: |
liugang@njpeptide.com |
Products Intro: |
Product Name:β-Endorphin, porcine;YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
|
|
| Endorphin, porcine, - Basic information |
Product Name: | Endorphin, porcine, - | Synonyms: | Endorphin, porcine, -;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-VAL-LYS-ASN-ALA-HIS-LYS-LYS-GLY-GLN | CAS: | | MF: | | MW: | 0 | EINECS: | | Product Categories: | peptide | Mol File: | Mol File | |
| Endorphin, porcine, - Chemical Properties |
| Endorphin, porcine, - Usage And Synthesis |
| Endorphin, porcine, - Preparation Products And Raw materials |
|