LL-37
| Price | $7 |
| Package | 1KG |
| Min. Order: | 1KG |
| Supply Ability: | 100KG |
| Update Time: | 2020-02-14 |
Product Details
| Product Name: LL-37 | CAS No.: 154947-66-7 |
| Min. Order: 1KG | Purity: 99% |
| Supply Ability: 100KG | Release date: 2020/02/14 |
Product Name: LL-37
Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;[LL-37, 37 aa];Cathelicidin LL 37 (human);Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt)
CAS: 154947-66-7
MF: C205H340N60O53
MW: 0
EINECS: -0
Product Categories:
Mol File: Mol File
LL-37 Structure
Company Profile Introduction
Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals.
Mainly deals in the sales of:
Pharmaceutical intermediates
OLED intermediates：
Pharmaceutical intermediates;
OLED intermediates;
You may like
Recommended supplier
| Product name | Price | Suppliers | Update time | |
|---|---|---|---|---|
| $0.00/10KG |
VIP3Y
|
Shandong Hanjiang Chemical Co., Ltd
|
2025-10-09 | |
| $0.00/1Box |
VIP1Y
|
Shanghai Yimeixin Technology Co., LTD
|
2025-09-26 | |
| $30.00/1kit |
VIP1Y
|
Shenzhen Aoxi Technology Co., Ltd.
|
2025-09-04 | |
| $10.00/1box |
VIP1Y
|
Ningbo Qingteng Plastic Cost.,Ltd.
|
2025-07-23 | |
| $5.00/1BOX |
VIP2Y
|
Hebei Jiafan Trading Company Limited
|
2025-05-22 | |
| $20.00/1kg |
Shaanxi Franta Biotechnology Co., Ltd
|
2024-12-05 | ||
| $0.00/1BOX |
VIP2Y
|
Shandong Huizhihan Supply Chain Co., Ltd
|
2024-10-30 | |
| $80.00/1Box |
Qingdao Xinli Technology Development Co., Ltd.
|
2024-07-25 | ||
| $35.00/1box |
Hebei Xinsheng New Material Technology Co., LTD.
|
2024-05-28 | ||
| $85.00/1box |
Strong peptide cross-border e-commerce Co. LTD
|
2024-05-23 |
China- Since: 2014-12-17
- Address: 702, Building 10, East District, National University Science and Technology Park, High tech Zone, Zh
INQUIRY