ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
Urocortin III, mouse 357952-10-4
TGF α (1-50) (rat)
Thymosin α1 (deacetylated) (human, bovine, mouse, rat)
Tyr-α-CGRP (23-37) (canine, mouse, rat)
TPCK 402-71-1
Tyr-Leptin (26-39) (human) 309247-25-4
TRH 40216-95-3
TIPP 146369-65-5
Tyr-PDGF A-Chain (194-211) 137132-69-5
Tyrosinase (243-251) (human) 197171-78-1
TACE (ADAM-17)
Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
TRH-βNA
uPAR (84-95) (human)
Tyr-Amyloid P Component (27-38) amide 198268-71-2
Urinary Trypsin Inhibitor Fragment 164859-77-2
Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide, Urodilatin, human;TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfidebridge:11-27) 115966-23-9
Thymus and Activation-Regulated Chemokine (human) 439555-96-1
Thymic Humoral Gamma 2 Factor
Tyrosinase (192-200)??;SEIWRDIDF 170294-35-6
TRH-AMC 190836-86-3
Tos-Gly-Pro-Lys-pNA 73392-19-5
Urocortin III, human 357952-09-1
SV40 NLS??;PKKKRKVG
TNF - α (72 - 82), human
TRAP-5
TRAP-14 amide 141923-36-6
Thrombin Receptor Agonist (FLLRN);FLLRN 141136-84-7
Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine)
Thymosin β4 (16-38)
Tyr-α-CGRP (human) 124756-98-5
Syndyphalin SD-33 87636-57-5
Tyr-(Glu1)-Sauvagine
TAT 697226-52-1
Thymopoietin II (33-36) 75957-56-1
Tuftsin 72103-53-8
Thymosin b4 (16-38) 113318-05-1
Type B Allatostatin
Tyr-Big Endothelin-1 fragment (22-38) (human) 348128-18-7
Tax8, HTLV-1 (12-19)??;LFGYPVYV
Thymopoietin (TP) Fragments
Tyr0-Secretin (Porcine)
Urocortin III, mouse, free acid
Thrombin Receptor (42-48) Agonist, human;SFLLRNP 145229-76-1
Tyr-Proinsulin C-Peptide (55-89) (human)
Tritrpticin 179264-81-4
Thrombospondin Analog 143740-28-7
TLCK 2364-87-6
Thymopoietin II (34-36) 75958-14-4
Synapsin I-derived peptide??;LRRRLSDANF-NH2
TNF-α(78-96) (human)
TRAP-6 amide
Urechistachykinin I
Tropoelastin Fragment
T-F-Q-A-Y-P-L-R-E-A 117592-22-0
Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) 185032-24-0
Tyr-ACTH (4-9) 129813-57-6
Thrombin Receptor Agonist,amide (SFLLR-NH2);SFLLR-NH2 141923-41-3
Tripeptide-2 64577-63-5
Uperolein
T Cell Activation Gene-3 (mouse)
Thymosin β4 (human, bovine, horse, rat)
Transduction Peptide 1 (α II) Cat #:86740
Tyr-Uroguanylin (rat)
Thymosin β10 (human, rat) 88160-82-1
TAT 2-4 1159916-66-1
Thymosin-α1
Suc-Tyr-Val-Ala-Asp-AMC 201860-29-9
Tos-Gly-Pro-Arg-AMC · HCl 117961-27-0
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
Tax9, HTLV-1 (11-19??;LLFGYPVYV
Thymosin and Fragments
Tyr-Specific Protein Kinase Inhibitor
Urokinase substrate, Z-γ-Glu(tBu)-Gly-Arg-pNA
Thrombin (B 147-158) (human) 207553-42-2
Pentapeptide-1 69558-55-0
TIMP-2 (145-168) (human, bovine) 1872435-10-3
T-7 Peptide
TNF-α(71-82), human
TRAP-7
Thymopoietin I/II (29-41) (bovine) 56795-64-3
Tos-Gly-Pro-OH 100723-71-5
Thyrotropin Releasing Hormone Precursor Peptide: TRH Precursor Peptide;KRQHPGKR
Tertiapin
Thyrotropin Releasing Hormone, free acid: TRH, free acid;Pyr-HP 34367-54-9
Urocortin II, human 398001-88-2
Suc-Tyr-Leu-Val-pNA
Suc-Tyr-Val-Ala-Asp-pNA 208264-84-0
Thymopoietin II (32-36)-ethyl ester 283167-49-7
Tos-Gly-Pro-Lys-AMC 128202-25-5
Trypanothione
Tyrosine Protein Kinase JAK 2;VLPQDKE-pY-pY-KVKEPGE
Thymosin-α1, [Ac-Tyr0]-
Transforming Growth Factor β1 Peptide, TGF - β1 (60 - 66), amide
Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) 496849-46-8
Thrombin Receptor Activator for Peptide 6 (TRAP-6);SFLLRN 141136-83-6
Tachyplesin I
Suc-Val-Pro-Phe-pNA 95192-11-3
TTA-386 152847-08-0
TIP 39, Tuberoinfundibular Neuropeptide;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 277302-47-3
69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.