ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
PrP (106-126);KTNMKHMAGAAAAGAVVGGLG 148439-49-0
Prion Protein (106-126) (human) (scrambled) 150469-23-1
Prion Protein (118-135) (human) 202121-03-7
pro-ε-Tx1X/12??;LKRTIRTRLNIR
Pro-Adrenomedullin (12-20) human;KWNKWALSR-NH2 186027-43-0
Pro-Adrenomedullin: 153-185, human
Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)
PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Pep2-AVKI 1315378-69-8
Pep2-EVKI 1315378-67-6
Pep2-SVKI 328944-75-8
Pep4c 243843-43-8
Peptide 6A 73549-32-3
Peptide 74
Peptide 810 156371-22-1
Peptide F, bovine
Peptide M 110652-62-5
PLP 190-209
Polistes Mastoparan 74129-19-4
Parathyroid Hormone (1-34), bovine;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 12583-68-5
PDGF β-Receptor (719-723) (phosphorylated)
Pentagastrin 50 μg/vial (Clinalfa basic)
Pep1-TGL
Pep2-SVKE 1315378-76-7
PLM derived peptide??;IRRLSTRRR-OH
PLP 184-199
Pneumadin (rat) 130918-90-0
pTH (28-48) (human) 83286-22-0
PB1(703-711), Influenza??;SSYRRPVGI
PDGF Antagonist 143784-00-3
Pedibin Precursor (hydra)
Pep1-AGL
Pep2m 243843-42-7
Peptide 46 192122-40-0
Peptide B, bovine
Peptide F (22-34) (bovine, ovine) 88878-74-4
Platelet-Derived Growth Factor Receptor Substrate 2;SVL-pY-TAVQPNE
PLP 41-58
Pol-RFamide 119116-89-1
Polylysine 25104-18-1
Polyphemusin II-Derived Peptide 229030-20-0
Pompilidotoxin, ?- 216064-36-7
pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide, Phosphorylated;TSTEPQ-pY-QPGENL 149299-77-4
Preangiotensinogen (11-14) (human)
Prepro-ANF: 104-116, human
Prepro Corticotropin Releasing Factor (125-151), human
TRH-Potentiating Peptide
Prepro-TRH (178-199) 122018-92-2
Prepro TRH (53-74)
Prepro VIP/PHM: 111-122
Prepro VIP/PHM: 156-170 107902-86-3
Prepro VIP: 81-122, human
Prepro-adrenomedullin (153-185), human;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Prepro-Atrial Natriuretic Factor (104-123) (human) 112160-83-5
Prepro-CNP: 1-27, rat
Preproenkephalin B (186-204), human
Preprogalanin 28-67, rat
Prepro-Nerve Growth Factor (99-115) (mouse)
Prepro-Neuromedin S (70-103) (human) 894454-10-5
Prepro-Neuromedin U (104-136) (human)
Procathepsin B (26-50) (rat) 317331-27-4
Procathepsin B (36-50) (rat) 317331-26-3
Procollagen Type I (212-216) 149128-48-3
Procollagen α1 (1187-1218) (human)
Pro-Cortistatin (28-47)
Pro-Cortistatin (51-81)
Prodynorphin: 228-256
proFIX18??;TVFLDHENANKILNRPKR
proFIX28??;TVFLDHENANKILNRPKRYNSGKLEEFV
Proinsulin (31-65), human, Tyr-
Prolactin Releasing Peptide (12-31), bovine;TPDINPAWYAGRGIRPVGRF-NH2
Prolactin Releasing Peptide (1-31), human;SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 235433-36-0
Prolactin Releasing Peptide (12-31), rat;TPDINPAWYTGRGIRPVGRF-NH2 222988-10-5
Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
Prolactin Releasing Peptide (1-31), HumanPrRP-31
Prolactin Releasing Peptide (1-31), rat;SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 215510-06-8
Prolactin Releasing Peptide-20 (PrRP-20), bovine
Prolactin Releasing Peptide-31 (24-31), bovine: PrRP-
Prolactin Releasing Peptide-31 (PrRP-31), bovine
Prolactin Releasing Peptides and Related Peptides
Propionyl-Amyloid β-Protein (31-34) amide
Preptin (rat) 315197-73-0
Pre-S1 (12-32)
Pre-S2 (1-26) 104753-45-9
Presenilin-1 (331-349)-Cys (human, mouse) 317335-35-6
Prion Protein (106 - 126)
proPT18??;HVFLAPQQARSLLQRVRR
proPT28??;HVFLAPQQARSLLQRVRRANTFLEEVRK
Prosaptide TX14(A) 196391-82-9
Prosaptide, wild type
Protease - Activated Receptor2
Protease Substrates
Protein G B1 Domain (41-56) 160291-75-8
PKI Inhibitor (6-22), amide;TYADFIASGRTGRRNAI-NH2 121932-06-7
PKC (530-558);LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2 122613-29-0
pTH (1-44) (human) 85568-24-7
Parathyroid Hormone (PTH) and Related Peptides
pTH (1-38) (human) 104218-12-4
Platelet-Derived Growth Factor ?-Receptor (739-746);pY-MAPYDNY
Pep 4AK;KKKGSVVIVGRIILSGR-NH2
65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.