Chem-Impex International, Inc.

Main products:

Current Location: HOME >> Product
Product Categories
Company Name:Chem-Impex International, Inc.
Tel:800 869-9290 US and Canada only
Fax:630 766-2218
Email:
WebSite:www.chemimpex.com
Product Total:6750
CB Index:64
Nationality:United States
Product Name MF CAS Details
Methyl ethanesulfonate C6H13NO4S 1912-28-3 Details
4-Chlorophenethylamine C11H9ClN4 156-41-2 Details
H-TRP-PHE-TYR-SER(PO3H2)-PRO-ARG-AMC C53H62N11O13P Details
2-(Boc-aminomethyl)-piperidine C11H22N2O2 141774-61-0 Details
Phenylhydrazine hydrochloride C6H9ClN2 59-88-1 Details
PHT-LYS-OH C14H16N2O4 41440-64-6 Details
(DES-PYR1)-LHRH C50H70N16O11 38280-53-4 Details
ALPHA-D-CELLOBIOSE OCTAACETATE C28H38O19 3616-19-1 Details
Sodium cacodylate trihydrate C2H12AsNaO5 6131-99-3 Details
2H-PYRAN-3(4H)-ONE, DIHYDRO- C5H8O2 23462-75-1 Details
2-ETHOXY-5-[(MORPHOLINE-4-CARBONYL)-AMINO]-BENZENESULFONYL CHLORIDE C13H17ClN2O5S 680618-10-4 Details
AC-LYS(AC)-D-ALA-D-ALA-OH C16H28N4O6 24570-39-6 Details
Z-GLY-GLY-TRP-OH C23H24N4O6 83798-91-8 Details
ANTI-KENTSIN C22H45N11O6 73430-00-9 Details
4-METHYLUMBELLIFERYL ALPHA-L-RHAMNOPYRANOSIDE C16H18O7 106488-05-5 Details
2-HYDRAZINO-1,3-BENZOXAZOLE C7H7N3O 15062-88-1 Details
2-AMINOOCTANE C8H19N 693-16-3 Details
SAR-PRO-OH C8H14N2O3 Details
BOC-BETA-HOHYP(BZL)-OH DCHA C30H48N2O5 Details
3,5-Difluorobenzyl bromide C7H5BrF2 141776-91-2 Details
H-GLU(OME)-OTBU HCL C10H20ClNO4 Details
BOC-ALA-ALA-GLY-PNA C19H27N5O7 90037-94-8 Details
ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 C149H234N40O47S 133514-43-9 Details
FMOC-TIC-WANG RESIN C25H20NO3R Details
5-Hydroxytryptophan C11H12N2O3 56-69-9 Details
5-CHLORO-2-FLUORO-BENZAMIDINE HYDROCHLORIDE C7H7Cl2FN2 1187929-52-7 Details
NEUROPEPTIDE SF (HUMAN) C65H94N18O15 192387-39-6 Details
LIGHT GREEN SF YELLOWISH C37H34N2Na2O9S3 5141-20-8 Details
Doxorubicin hydrochloride C27H30ClNO11 25316-40-9 Details
H-TYR(TRT)-2-CHLOROTRITYL RESIN Details
Tris(hydroxymethyl)aminomethane acetate salt C4H11NO3.C2H4O2 6850-28-8 Details
(PYR4,CYS(H-CYS-OH)6,ARG8)-VASOPRESSIN (4-8) C26H42N10O10S2 Details
Salicylaldoxime C7H7NO2 94-67-7 Details
4-Amidinophenylmethanesulfonyl fluoride hydrochloride C8H10ClFN2O2S 74938-88-8 Details
H-ASP-PHE-ASP-MET-LEU-ARG-CYS-MET-LEU-GLY-ARG-VAL-PHE-ARG-PRO-CYS-TRP-GLN-TYR-OH C109H160N30O26S4 160201-86-5 Details
CALCIUM HYDRIDE CaH2 7789-78-8 Details
H-TYR-GLY-ARG-LYS-LYS-ARG-ARG-GLN-ARG-ARG-ARG-OH C64H118N32O14 191936-91-1 Details
H-VAL-D-PRO-PRO-OH C15H25N3O4 Details
3-INDOXYL PHOSPHATE DISODIUM SALT C8H6NNa2O4P 3318-43-2 Details
FMOC-ASN(TRT)-GLY-OH C40H35N3O6 Details
4-BROMO-2,3-DIHYDRO-INDOLE-1-CARBOXYLIC ACID TERT-BUTYL ESTER C13H16BrNO2 885272-46-8 Details
(D-PHE12,NLE21,38,ALPHA-ME-LEU37)-CORTICOTROPIN-RELEASING FACTOR (12-41) (HUMAN, RAT) C159H267N49O43 Details
H-GLY-PRO-GLY-OH C9H15N3O4 2441-63-6 Details
7-Bromoindole C8H6BrN 51417-51-7 Details
1-BOC-3-BROMO-5-FLUORO-INDAZOLE C12H12BrFN2O2 885271-57-8 Details
H-TYR-D-MET(O)-GLY-N-ME-PHENYLALANINOL C25H34N4O6S Details
PHT-GLY-OTBU C14H15NO4 6297-93-4 Details
H-TYR-GLY-GLY-PHE-LEU-LYS-OH ACETATE SALT C36H53N7O10 83404-43-7 Details
1-BOC-3-FORMYL-4-OXO-PIPERIDINE C11H17NO4 100501-55-1 Details
H-CYS-TYR-ILE-GLN-ASN-CYS-PRO-LEU-GLY-NH-CH2CH2F C45H71FN12O12S2 Details
FMOC-D-TIC-WANG RESIN C25H20NO3X Details
FMOC-3,4-DEHYDRO-VAL-OH C20H19NO4 Details
Cytidine 5'-triphosphate disodium salt C9H14N3Na2O14P3 36051-68-0 Details
BOC-L-3-NITROPHENYLALANINE C14H18N2O6 131980-29-5 Details
H-ALA-SER-ALA-SER-SER-LEU-MET-ASP-LYS-GLU-ALA-VAL-TYR-PHE-ALA-HIS-LEU-ASP-ILE-ILE-TRP-OH C109H163N25O32S 121204-87-3 Details
(R)-GAMMA-(4-IODO-BENZYL)-L-PROLINE-HCL C12H15ClINO2 Details
2,3,5-TRIFLUORO-PYRIDIN-4-YLAMINE C5H3F3N2 105252-95-7 Details
H-CYS-ASP-PRO-GLY-TYR-ILE-GLY-SER-ARG-NH2 C40H63N13O13S 110590-61-9 Details
NPYS-GLY-OH C7H7N3O4S 77357-00-7 Details
Ubidecarenone C59H90O4 303-98-0 Details
1-[2-(2-METHOXY-ETHOXY)-PHENYL]-PIPERAZINE C13H20N2O2 891782-62-0 Details
2-Cyano-3-nitropyridine C6H3N3O2 51315-07-2 Details
HATU C10H15N6O.F6P 148893-10-1 Details
BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT) C199H299N57O59S2 213779-13-6 Details
Ethyl indole-3-carboxylate C11H11NO2 776-41-0 Details
(VAL3)-BETA-CASOMORPHIN (1-4) AMIDE (BOVINE) ACETATE SALT C26H39N5O7 104180-22-5 Details
BENZYL (+/-)-TRANS-N-BOC-4-METHYL-PIPERIDINE-2-CARBOXYLATE C19H27NO4 339183-92-5 Details
BOC-3-(3'-QUINOLYL)-D-ALANINE C17H20N2O4 135101-19-8 Details
5-AMINOMETHYL-PYRIDINE-2-CARBONITRILE C7H7N3 182291-88-9 Details
CNP-53 (PORCINE, RAT) Details
5-NITRO-1H-INDAZOLE-7-CARBOXYLIC ACID METHYL ESTER C9H7N3O4 632291-85-1 Details
2-Methoxybenzonitrile C8H7NO 6609-56-9 Details
3-CYANO-L-PHENYLALANINE HCL C10H11ClN2O2 Details
6-CHLORO-3-INDOLYL ACETATE C10H8ClNO2 114305-99-6 Details
1-CYCLOHEXYL-3-ETHYL-6-FLUORO-1H-INDAZOLE C15H19FN2 224048-17-3 Details
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 C186H312N52O52S2 357952-10-4 Details
H-LEU-TYR-ILE-ASP-PHE-ARG-LYS-ASP-LEU-GLY-OH C58H90N14O16 Details
GRB2 SH2 DOMAIN LIGAND C23H36N5O10P 168423-05-0 Details
3-CHLORO-5-HYDROXY-BENZOIC ACID C7H5ClO3 53984-36-4 Details
METHYL 3-FORMYLINDOLE-6-CARBOXYLATE C11H9NO3 133831-28-4 Details
Tetrahydropyran-4-carbaldehyde C6H10O2 50675-18-8 Details
5-FLUOROINDOLE-3-ACETIC ACID HYDRAZIDE C10H10FN3O 376646-57-0 Details
D-HISTIDINE HYDROCHLORIDE MONOHYDRATE C6H12ClN3O3 Details
H-D-GLU(OTBU)-OH C9H17NO4 45125-00-6 Details
FMOC-PRO-OPFP C26H18F5NO4 86060-90-4 Details
H-TRP-2-CHLOROTRITYL RESIN C11H11N2OR Details
FMOC-D-ALLO-ILE-OH C21H23NO4 118904-37-3 Details
ALPHA-AMINOISOBUTYRIC ACID T-BUTYL ESTER C8H17NO2 4512-32-7 Details
H-ALA-D-ALA-OH C6H12N2O3 3695-80-5 Details
FMOC-3-AMINOPENTANE-3-CARBOXYLIC ACID C21H23NO4 Details
Ammonium citrate dibasic C6H14N2O7 3012-65-5 Details
1,12-Dodecanediamine C12H28N2 2783-17-7 Details
FMOC-D-LYS(Z)-OH C29H30N2O6 110990-07-3 Details
Z-D-ASP(OBZL)-OH C19H19NO6 5241-62-3 Details
PHENACETURIC ACID C10H11NO3 500-98-1 Details
PROLINOL 2-CHLOROTRITYL RESIN Details
Z-D-GLU(OME)-OH C14H17NO6 27025-24-7 Details
(S)-(-)-2-Azetidinecarboxylic acid C4H7NO2 2133-34-8 Details
AC-LYS (AC)-OH C10H18N2O4 499-86-5 Details
Boc-L-Glutamic acid 1-benzyl ester C17H23NO6 30924-93-7 Details
Product Total: Product Page:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68