Back to ChemicalBook Home--->CAS DataBase List--->141758-74-9

141758-74-9

141758-74-9 Structure

141758-74-9 Structure
IdentificationBack Directory
[Name]

Exendin-4
[CAS]

141758-74-9
[Synonyms]

EXENDIN-4
Exendin-4 Exenatide
M.W. 4186.61 C184H282N50O60S
Exenatide, AC 2993, Exendin A, ExendinA
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
[EINECS(EC#)]

686-356-3
[Molecular Formula]

C184H282N50O60S1
[MDL Number]

MFCD00240171
[MOL File]

141758-74-9.mol
[Molecular Weight]

4186.57
Chemical PropertiesBack Directory
[RTECS ]

VT9545000
[storage temp. ]

−20°C
[form ]

White to off-white solid.
Hazard InformationBack Directory
[Definition]

ChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.
[Description]

Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. The dosing regimen for exenatide is 5 or 10 mg twice daily, administered as a subcutaneous injection within an hour before morning and evening meals. Following subcutaneous administration, peak plasma concentrations of exenatide are reached in 2.1 h, and the plasma pharmacokinetic profile is dose proportional. The most common adverse events reported with exenatide include nausea, vomiting, diarrhea, feeling jittery, dizziness, headache, and dyspepsia.
[Originator]

Amylin (US)
[Brand name]

Byetta
[General Description]

Exendin-4 is an incretin mimetic peptide, which is composed of 39 amino acids. It is an analog of glucagon-like peptide 1 (GLP-1), and an insulinotropic agent, with a long half-life. Exendin-4 was historically isolated from the venom of Gila monster lizard called Heloderma suspectum.
[Biochem/physiol Actions]

Activates GLP-1 (glucagon-like peptide-1) receptors to increase intracellular cAMP in pancreatic acinar cells; has no effect on VIP receptors.
Safety DataBack Directory
[WGK Germany ]

3
[HS Code ]

2933290000
[Hazardous Substances Data]

141758-74-9(Hazardous Substances Data)
Questions And AnswerBack Directory
[New diabetes drugs]

Diabetes is a metabolic disorder characterized by chronic hyperglycemia caused by a variety of causes , high blood sugar is caused by insulin secretion or its effect defect. Diabetes can be divided into type 1 diabetes, type 2 diabetes, other specific types of diabetes, and gestational diabetes, among which type 2 diabetes account for more than 90%.
Exendin-4 is a new diabetes drug successfully developed by American Eli Lilly Company it belongs to incretin analogues, it is the first member of the incretin analogues family , it is the synthetic peptide compound, which can simulate physiological behavior of the natural state secretion of GLP-1 in vivo ,it is similar to human pancreatic glucagon-like peptide effect-1 (GLP-1),it can promote glucose-dependent insulin secretion, it has inhibition effect of inappropriate glucose-dependent glucagon secretion, slowing gastric emptying, it improves the sensitivity of peripheral tissues to insulin, and it makes blood sugar adequately controlled. Clinically it is used for the treatment of type Ⅱ diabetes patients whose blood sugar is unbale to be controlled by metformin, sulfonylurea, or combination of metformin and sulfonylurea.
From April 28, 2005 to October 29, 2008, the US Food and Drug Administration (abbreviation: FDA) Adverse Event Reporting System had received reports of 78 cases of patients with renal exenatide change. In the meantime, the United States had made a total of more than 6.6 million Exendin-4 prescription, therefore, FDA thought the received 78 cases was in a small proportion of the proportion of all patients reporting use of the drug. Currently FDA has completed an assessment of these reported cases, including 62 cases of acute renal failure cases and 16 cases of renal insufficiency cases. Acute renal failure or renal dysfunction occurs three days to two years after treatment. The age span is 23 years to 83 years, mean age is 60 years.
The above information is edited by the chemicalbook of Tian Ye.
[Uses]

Exendin-4 can activate the GLP-1 receptor, the receptor can increase cAMP levels of pancreatic acinar cells in intracellular , but it has no effect on VIP receptor.
141758-74-9 suppliers list
Company Name: SUZHOU TIANMA PHARMA GROUP TIANJI BIO-PHARMACEUTICAL CO., LTD.
Tel: 18315825527
Fax:
Website: www.tianjibio.com
Company Name: Alpha Biopharmaceuticals Co., Ltd
Tel: 0086-411-39042497
Fax: 0086-411-39042693
Website: http://www.alphabiopharm.com/
Company Name: Henan Tianfu Chemical Co.,Ltd.
Tel: 0371-55170693
Fax: 0371-55170693
Website: http://www.tianfuchem.net/
Company Name: career henan chemical co
Tel: +86-0371-55982848
Fax:
Website: www.coreychem.com/index.html
Company Name: Hubei Jusheng Technology Co.,Ltd.
Tel: 86-18871470254
Fax: 027-59599243
Website: www.hubeijusheng.com
Company Name: Chongqing Chemdad Co., Ltd
Tel: +86-13650506873
Fax:
Website: http://www.chemdad.com/
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 , 18156095617
Fax: 0551-65326641
Website: http://www.cellmano.com/
Company Name: Hebei shuoxi biotechnology co. LTD
Tel: +8613081092107
Fax: whatsapp:+8613081092107
Website: www.hbshuoxi.com
Company Name: Zhuozhou Wenxi import and Export Co., Ltd
Tel: +8613111626072 (WhatsApp)
Fax: Wechat: +8613111626072 Wickr me: waynehu
Website: www.wenxichem-pharma.com
Company Name: Fuxin Pharmaceutical
Tel: 021-50872116
Fax:
Website: www.fuxinpharm.com
Company Name: SIMAGCHEM CORP
Tel: +86 13806087780 , 13806087780
Fax:
Website: www.simagchem.com
Company Name: Hebei Binshare New Material Co. Ltd
Tel: +86-86-18633865755 , +8618633865755
Fax:
Website: https://www.binsharematerial.com/
Company Name: Target Molecule Corp
Tel: 781-999-5354 , 18019718960
Fax:
Website: https://www.targetmol.com/
Company Name: Hefei TNJ Chemical Industry Co.,Ltd.
Tel: 0551-65418671
Fax: 0551-65418697
Website: https://www.tnjchem.com
Company Name: HANGZHOU CLAP TECHNOLOGY CO.,LTD
Tel: 86-571-88216897、88216896 , 13588875226
Fax: 86-571-88216895
Website: www.hzclap.com/en
Company Name: Hebei shenghao import and export trade co. LTD
Tel: 18431136903
Fax:
Website:
Company Name: Dideu Industries Group Limited
Tel: 029-88380327; 17691182729
Fax:
Website: www.dideu.com
Company Name: Finetech Industry Limited
Tel: 86 27 87465837
Fax: 86 27 87772287
Website: www.finetechnology-ind.com
Tags:141758-74-9 Related Product Information
657-24-9 782500-75-8 60731-46-6 51110-01-1 57773-63-4 10418-03-8 65807-02-5 64-77-7 135062-02-1 122320-73-4 274901-16-5 204656-20-2 320367-13-3 141732-76-5