CJC1295

CJC1295 Chemische Eigenschaften,Einsatz,Produktion Methoden

Beschreibung

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

Verwenden

CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.

Pharmakologie

By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.

Clinical Use

CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.

Nebenwirkungen

CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.

CJC1295 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte

CJC1295 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Firmenname	Telefon	E-Mail	Land	Produktkatalog	Edge Rate
Hebei Xunou new energy Technology Co., LTD	+undefined17531957005	xunou8@hbxunou.com	China	36	58
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.	+8618068519287	sales@xuanmingchem.com	China	822	58
Zhuzhou Yaozhijie Chemical Co., LTD	+8618073316972	sales@goodpeptides.com	China	244	58
Wuhan Godbullraw Chemical Co.,ltd	+undefined18986288449	Alisasales@godbullraw.com	China	560	58
Hebei Nafu Technology Co. , Ltd.	+8615075022224	17745771666@hebeinafu.com	China	325	58
Hubei Lange Biotechnology Co., Ltd.	+8617762501948	sales2@langebiotech.com	China	154	58
Hebei Yinsheng Technology Co., Ltd.	+86-17331136691	lemon@hbyinsheng.com	China	622	58
Hebei Gongyuan New Material Technology Co., Ltd.	+8617331136198	Grace@hebeisyjl.com	China	497	58
Wuhan Cell Pharmaceutical Co., Ltd	+86-13129979210 +86-13129979210	sales@cellwh.com	China	376	58
Hebei Mojin Biotechnology Co., Ltd	+8613288715578	sales@hbmojin.com	China	12456	58

863288-34-0()Verwandte Suche:

---

• CJC1295
• Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
• L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
• CJC-1295 CJC-1295
• CJC1295 with out DAC
• -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
• CJC-1295(2MG)
• CJC-1295(10mg)
• CJC-1295 Without DAC 86328-34-0
• CJC-1295 Acetate without DAC
• Peptides Bodybuilding cjc-1295
• Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials
• CJC1295 No DAC acetate
• CJC 1295 w/o DAC
• CJC1295 with DAC, MK677, Melanotan 2, huperzine A, minoxidil sulfate, RU58841, SAG
• CJC-1295 Acetate
• sarms CJC1295
• 863288-34-0
• 156-1-5
• 86328-34-0
• C159H258N46O45
• Peptides
• CJC
• 863288-34-0