ChemicalBook >> CAS DataBase List >>Calcitonin salmon

Calcitonin salmon

CAS No.
47931-85-1
Chemical Name:
Calcitonin salmon
Synonyms
tz-ct;SALMON;calcimar;Salcatonin;Salmotonin;Calcitoran;cibacalcin;Salcitonin;Salmon Calcium;Thyrocalcitonin
CBNumber:
CB2127316
Molecular Formula:
C145H240N44O48S2
Molecular Weight:
3431.85
MDL Number:
MFCD00133859
MOL File:
47931-85-1.mol
MSDS File:
SDS
Last updated:2024-04-12 23:00:59

Calcitonin salmon Properties

Melting point >222oC (dec.)
Density 1.54±0.1 g/cm3(Predicted)
storage temp. −20°C
solubility 0.05 M acetic acid: 1 mg/mL, clear, colorless
form powder
color White to Off-White
Water Solubility Soluble in water at 1mg/ml
Merck 13,1642
Sequence H-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2,(Disulfide bridge: Cys1-Cys7)
InChIKey IYTKRMFJECGBRF-LXQLIYPUSA-N
CAS DataBase Reference 47931-85-1(CAS DataBase Reference)
EWG's Food Scores 1
FDA UNII 7SFC6U2VI5

SAFETY

Risk and Safety Statements

Symbol(GHS)  GHS hazard pictograms
GHS06
Signal word  Danger
Hazard statements  H301
Precautionary statements  P301+P310+P330
Safety Statements  22-24/25
WGK Germany  3
RTECS  EV8000000
3-10
HS Code  2937190000

Calcitonin salmon price More Price(29)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich T3660 Calcitonin salmon ≥97% (HPLC), powder 47931-85-1 0.5mg $200 2024-03-01 Buy
Sigma-Aldrich T3660 Calcitonin salmon ≥97% (HPLC), powder 47931-85-1 250μg $332 2024-03-01 Buy
Sigma-Aldrich 1086200 Calcitonin salmon United States Pharmacopeia (USP) Reference Standard 47931-85-1 40MG $4190 2024-03-01 Buy
Sigma-Aldrich 05-23-2401 Calcitonin, Salmon Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes. 47931-85-1 25mg $685 2024-03-01 Buy
Sigma-Aldrich 1086200 Calcitonin salmon United States Pharmacopeia (USP) Reference Standard 47931-85-1 20mg $3447.15 2021-12-16 Buy
Product number Packaging Price Buy
T3660 0.5mg $200 Buy
T3660 250μg $332 Buy
1086200 40MG $4190 Buy
05-23-2401 25mg $685 Buy
1086200 20mg $3447.15 Buy

Calcitonin salmon Chemical Properties,Uses,Production

Description

Calcitonin Salmon (47931-85-1) is a polypeptide hormone secreted by the ultimobranchial gland of salmon. It belongs to the calcitonin-like protein family and can be used to treat Paget's disease of bone, postmenopausal osteoporosis(fragile or brittle bones), or high levels of calcium in the blood (hypercalcemia). It appears to have actions essentially identical to calcitonins of mammalian origin, but its potency per mg is greater and it has a longer duration of action. It works mainly by Inhibiting osteoclastic bone resorption, decreasing serum calcium, and increasing renal excretion of phosphate, calcium, sodium magnesium and potassium by decreasing tubular reabsorption.

Sequence

H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 acetate salt (Disulfide bond)

Biological Activity

Hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin also refers as thyrocalcitonin is a 32 amino acid peptide hormone, which is present abundantly in seminal plasma compare to serum. It acts as a first messenger and hence regulate the the production of cAMP as well as mammalian sperm function. It may also facilitate the regulation of different isoforms of adenylyl cyclase. Additionally, salmon calcitonin stimulates the bone formation and inhibits the bone resorption in postmenopausal osteoporotic women.

Active Substance

In humans, salmon calcitonin is more active than its human analog.
Calcitonin (salmon) positively influences bone remodelling and bone mass density due to its inhibiting effect on osteoclast activity. The beneficial effect of salmon calcitonin in the treatment of osteoporotic bone fractures is also due to the promotion of the cartilaginous phase of fracture healing and to pain relief.[www.bachem.com]

Application

1. Calcitonin salmon can be used for calcitonin receptor/cAMP assay for assessing the presence of calcitonin receptors expressed by TRAP+ cells.The product can also be used as a test compound for studying as well as comparing the impact of calcitonin gene related peptide (CGRP) and salmon calcitonin (sCT) on gastric mucosal barrier in rats exposed to cold + restraint stress (CRS). [sigma-aldrich]
2. Calcitonin, Salmon is a calcium regulating hormone secreted from mammalian thyroid parafollicular cells and in non-mammalian species from the ultimobranchial gland. Calcitonins are single chain polypeptides containing 32 amino-acid residues, showing hypocalcaemic and hypophosphatemic action, with amino-acid structure differing amongst mammalian species. Salmon calcitonin (salcatonin is the synthetic analogue) shows a markedly different sequence to that of the higher vertebrates as well as more potent activity. Eel calcitonin (Elcatonin) possesses a similar amino acid to that of the salmon form but is more stable than natural calcitonins because of the absence of disulfide bridges. [Santa Cruz Biotechnology]
3. It shows hypocalcaemic and hypophosphatemic action, with amino-acid structure differing amongst mammalian species. Salmon calcitonin (salcatonin is the synthetic analogue) shows a markedly different sequence to that of the higher vertebrates as well as more potent activity. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. [alfa-aesar]
4. Calcium-regulating peptide hormone released from the thyroid. Lowers calcium concentration in the blood and decreases bone resorption by osteoclasts. Used for therapeutic applications in osteoporosis. Salmon calcitonin peptide sequence differs from mammalian but is more potent.[Enzo Life Sciences, Inc.]

Indication

Calcitonin Salmon Can Used in the treatment of symptomatic Paget's disease for patients unresponsive to alternate treatments or intolerant to such treatments. In addition, it is used in emergency situations when serum calcium levels must be decreased quickly until the underlying condition is identified. It can also be added to existing therapeutic regimens for hypercalcemia such as intravenous fluids and furosemide, oral phosphate or corticosteroids, or other agents. Calcitonin can be used in patients with azotemia and cases where intravenous fluids would be contraindicated due to limited cardiac reserves. Also for the treatment of post-menopausal osteoporosis in women more than 5 years post-menopause.

Pharmacodynamics

Calcitonin inhibits bone resorption by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass and a reduction in plasma calcium levels. It also promotes the renal excretion of ions such as calcium, phosphate, sodium, magnesium, and potassium by decreasing tubular reabsorption. In consequence, there is an increase in the jejunal secretion of water, sodium, potassium, and chloride.

Mechanism of action

Calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
References: https://www.drugbank.ca/drugs/DB00017

References

1.http://www.usp.org
2.http://reference.medscape.com
3.https://www.drugs.com/cdi/calcitonin-salmon.html
4.http://www.rxlist.com/miacalcin-side-effects-drug-center.htm
5.http://www.rxlist.com/miacalcin-drug/clinical-pharmacology.htm

Description

Calcitonin is a single-chain polypeptide consisting of 32 amino acid residues. Calcitonins as obtained from different species are identical at seven of the first nine residues, contain Gly at position 28, and all terminate with Pro-NH2. The C-terminal proline amide (ProNH2) is very important for the biological function of CT, as is the disulfide bridge between Cys residues at positions 1 and 7. In contrast, the residues from 10 through 27 can be varied and seem to influence CT's potency as well as its duration of action. Salmon CT differs from human CT at 16 amino acid residues.

Chemical Properties

White or almost white powder.

Uses

Calcitonin salmon can be used for calcitonin receptor/cAMP assay for assessing the presence of calcitonin receptors expressed by TRAP+ cells.The product can also be used as a test compound for studying as well as comparing the impact of calcitonin gene related peptide (CGRP) and salmon calcitonin (sCT) on gastric mucosal barrier in rats exposed to cold + restraint stress (CRS).

Uses

Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease)

brand name

Calcimar (Rhone- Poulenc Rorer);.

Biochem/physiol Actions

Calcitonin also refers as thyrocalcitonin is a 32 amino acid peptide hormone, which is present abundantly in seminal plasma compare to serum. It acts as a first messenger and hence regulate the the production of cAMP as well as mammalian sperm function. It may also facilitate the regulation of different isoforms of adenylyl cyclase. Additionally, salmon calcitonin stimulates the bone formation and inhibits the bone resorption in postmenopausal osteoporotic women.

Clinical Use

Only salmon CT is commercially available for medical use, because on a weight basis, it is approximately 45-fold more potent than human CT. Salmon CT, in parenteral form, is approved for treating Paget's disease of bone (generally seen in older persons; involves increased bone resorption and softening of bones), postmenopausal osteoporosis, and hypercalcemia of malignancy (multiple myeloma or advanced breast carcinoma). Salmon CT also is available in a nasal spray formulation, which is used exclusively in the treatment of postmenopausal osteoporosis.

Veterinary Drugs and Treatments

In small animals, calcitonin has been used as adjunctive therapy to control hypercalcemia. Its use has been limited by expense, availability and resistance development to its effects after several days of treatment.

storage

Store at -20°C

Calcitonin salmon Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 386)Suppliers
Supplier Tel Email Country ProdList Advantage
Henan Bao Enluo International TradeCo.,LTD
+86-17331933971 +86-17331933971 deasea125996@gmail.com China 2503 58
Apextide Co Ltd
+undefined15700198315 senjie.hou@sinopep.com China 71 58
GIHI CHEMICALS CO.,LIMITED
+8618058761490 info@gihichemicals.com China 50000 58
Shanghai Getian Industrial Co., LTD
+86-15373193816 +86-15373193816 mike@ge-tian.com China 274 58
Zibo Hangyu Biotechnology Development Co., Ltd
+86-0533-2185556 +8617865335152 Mandy@hangyubiotech.com China 11013 58
Nantong Guangyuan Chemicl Co,Ltd
+undefined17712220823 admin@guyunchem.com China 616 58
Alpha Biopharmaceuticals Co., Ltd
+86-411-39042497 +8613921981412 sales@alphabiopharm.com China 886 58
Henan Tianfu Chemical Co.,Ltd.
+86-0371-55170693 +86-19937530512 info@tianfuchem.com China 21687 55
Hangzhou FandaChem Co.,Ltd.
008657128800458; +8615858145714 fandachem@gmail.com China 9340 55
Rixing Chemical CO.,LTD
+86-13237129059 -13237129059 sales@rixingchemi.com CHINA 229 55

Related articles

  • What is Calcitonin salmon?
  • Calcitonin is a human hormone. Salmon calcitonin and human calcitonin inhibit the function of osteoclasts, which are active in....
  • Sep 26,2023

View Lastest Price from Calcitonin salmon manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
Calcitonin salmon pictures 2024-05-15 Calcitonin salmon
47931-85-1
US $26.00 / box 1box 99% 20000 Shanghai Getian Industrial Co., LTD
Calcitonin salmon pictures 2024-05-10 Calcitonin salmon
47931-85-1
US $85.00-850.00 / KG 1KG 0.99 20 tons Zibo Hangyu Biotechnology Development Co., Ltd
Salmon Calcitonin Acetate pictures 2024-03-08 Salmon Calcitonin Acetate
47931-85-1
US $10.00 / kg 1kg 99% 1000kg Nantong Guangyuan Chemicl Co,Ltd
  • Calcitonin salmon pictures
  • Calcitonin salmon
    47931-85-1
  • US $85.00-850.00 / KG
  • 0.99
  • Zibo Hangyu Biotechnology Development Co., Ltd

Calcitonin salmon Spectrum

salmoncalcitonin-(i-32) salmoncalcitonini tz-ct Salmon Calcitonin Acetate Salcatonin CalcitoninAcetate Salmon Calcium M.W. 3431.90 C145H240N44O48S2 Calcitoran Salmotonin Calcitonin Acetate,form Salmon H-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 Thyrocalcitonin Salcitonin Acetate calcimar cibacalcin salmoncalcitonin CALCITONIN, SALMON CALCITONIN (SALMON I) CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7) CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7) H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2, (DISULFIDE BOND) THYROCALCITONIN SALMON SALMON CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2(DISULFIDE BRIDGE CYS1-CYS7) Salcitonin Calcitonin Salmon (20 mg) (COLD SHIPMENT REQUIRED) Salcitonin Acetate(SalMon Calcitonin) Salcatonin, SalMon Calcitonin, Thyrocalcitonin (salMon) SalMon Calcitonin Aceta H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU- Calcitonin (salMon) xAcetate H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 acetate salt (Disulfide bond) Salcitonin/Calcitonin Calcitonin(Salmone) Acetate Calcitonin salmon Acetate Calcitonin, salmon synthetic CALCITONIN SALMON 250 UG Salmon Calcitonin Acetate, ≥97% (HPLC) Salcatonin for Injection  Calcitonin Salmon RS Calcitonin?(Salmon) impurity Cyclic (1→7)-disulfide L-Cysteinyl-L-seryl-L-asparaginyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-α-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyros Salmon calcitonin USP/EP/BP Calcitonin salmon USP/EP/BP Salcatonin,Calcitonin (Salmon) Calcitonin (salmon) (C0200000) Calcitonin Salmon (COLD SHIPMENT REQUIRED) (1086200) Calcitonin salmon/Thyrocalcitonin Salmon Calcitonin Impurities Calcitonin Salmon (40 mg) (COLD SHIPMENT REQUIRED) 47931-85-1 C145H240N44O48S2 Cell Biology