ChemicalBook
Chinese English Japanese Germany Korea

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 구조식 이미지
카스 번호:
119977-20-7
상품명:
FIBRONECTIN-BINDING PROTEIN PEPTIDE D3
동의어(영문):
FIBRONECTIN-BINDING PROTEIN;FIBRONECTIN BINDING PROTEIN PEPTIDE;FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV;FIBRONECTIN-BINDING PROTEIN PEPTIDE D3;Fibronectin Binding Protein Peptide, D3 Peptide;H-PHE-ASN-LYS-HIS-THR-GLU-ILE-ILE-GLU-GLU-ASP-THR-ASN-LYS-ASP-LYS-PRO-SER-TYR-GLN-PHE-GLY-GLY-HIS-ASN-SER-VAL-ASP-PHE-GLU-GLU-ASP-THR-LEU-PRO-LYS-VAL-OH
CBNumber:
CB5726066
분자식:
C190H283N49O66
포뮬러 무게:
0
MOL 파일:
Mol file

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 속성

저장 조건
-15°C

안전

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 C화학적 특성, 용도, 생산

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 준비 용품 및 원자재

원자재

준비 용품


FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 공급 업체

글로벌( 15)공급 업체
공급자 전화 팩스 이메일 국가 제품 수 이점
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky (shanghai) International Co.,Ltd 021-50135380
shchemsky@sina.com China 15426 60
Wuxi Asia Peptide Biotechnology Limited Company +86 (510) 8358-3050
+86 (510) 8358-3039 willsun@peptide-search.com China 8790 58
Nanjing Leon Biological Technology Co., Ltd. +86 (25) 8452-3390 ex 127
+86 (25) 8452-0790 sales@njleonbiotech.com China 5513 55
Nanjing Peptide Biotech Ltd. 18751911884
025-58361107-806 liugang@njpeptide.com China 9952 55
Nanjing Meihao Pharmaceutical Technology Co., Ltd. meitaochem@126.com
meitaochem@126.com China 19112 58
United States Biological --
-- sales@advtechind.com United States 6126 58

Copyright 2019 © ChemicalBook. All rights reserved