Exendin-4
|
- $72 - $2050
- Product name: Exendin-4
- CAS: 141758-74-9
- MF: C184H282N50O60S
- MW: 4186.57188
- EINECS:686-356-3
- MDL Number:MFCD00240171
- Synonyms:EXENDIN-4;M.W. 4186.61 C184H282N50O60S;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide;Exenatide (Exendin-4);Exenatide free base
17 prices
Selected condition:
Brand
- AK Scientific
- ApexBio Technology
- ChemScene
- DC Chemicals
- Sigma-Aldrich
- Tocris
- Usbiological
Package
- 0.1mg
- 500μg
- 1mg
- 2.73mg
- 1
- 5mg
- 10mg
- 20mg
- 25mg
- 50mg
- 100mg
- 500mg
- ManufacturerAK Scientific
- Product numberR075
- Product descriptionExenatideacetate
- Packaging1mg
- Price$225
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA3408
- Product descriptionExendin 4
- Packaging20mg
- Price$200
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA3408
- Product descriptionExendin 4
- Packaging50mg
- Price$418
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA3408
- Product descriptionExendin 4
- Packaging100mg
- Price$679
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA3408
- Product descriptionExendin 4
- Packaging500mg
- Price$1672
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-1174
- Product descriptionExendin 4 99.98%
- Packaging1mg
- Price$72
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-1174
- Product descriptionExendin 4 99.98%
- Packaging5mg
- Price$168
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-1174
- Product descriptionExendin 4 99.98%
- Packaging10mg
- Price$252
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-1174
- Product descriptionExendin 4 99.98%
- Packaging25mg
- Price$360
- Updated2021-12-16
- Buy
- ManufacturerDC Chemicals
- Product numberDC22518
- Product descriptionExenatide >98%
- Packaging5mg
- Price$128
- Updated2021-12-16
- Buy
- ManufacturerDC Chemicals
- Product numberDC22518
- Product descriptionExenatide >98%
- Packaging25mg
- Price$348
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberE7144
- Product descriptionExendin 4 ≥97%
- Packaging0.1mg
- Price$334
- Updated2026-03-19
- Buy
- ManufacturerSigma-Aldrich
- Product numberE7144
- Product descriptionExendin 4 ≥97%
- Packaging500μg
- Price$988
- Updated2026-03-19
- Buy
- ManufacturerSigma-Aldrich
- Product number1269105
- Product descriptionExenatide United States Pharmacopeia (USP) Reference Standard
- Packaging2.73mg
- Price$2050
- Updated2026-03-19
- Buy
- ManufacturerTocris
- Product number1933
- Product descriptionExendin 4
- Packaging1
- Price$393
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberE9050-02
- Product descriptionExendin 4
- Packaging1mg
- Price$672
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| AK Scientific | R075 | Exenatideacetate | 1mg | $225 | 2021-12-16 | Buy |
| ApexBio Technology | A3408 | Exendin 4 | 20mg | $200 | 2021-12-16 | Buy |
| ApexBio Technology | A3408 | Exendin 4 | 50mg | $418 | 2021-12-16 | Buy |
| ApexBio Technology | A3408 | Exendin 4 | 100mg | $679 | 2021-12-16 | Buy |
| ApexBio Technology | A3408 | Exendin 4 | 500mg | $1672 | 2021-12-16 | Buy |
| ChemScene | CS-1174 | Exendin 4 99.98% | 1mg | $72 | 2021-12-16 | Buy |
| ChemScene | CS-1174 | Exendin 4 99.98% | 5mg | $168 | 2021-12-16 | Buy |
| ChemScene | CS-1174 | Exendin 4 99.98% | 10mg | $252 | 2021-12-16 | Buy |
| ChemScene | CS-1174 | Exendin 4 99.98% | 25mg | $360 | 2021-12-16 | Buy |
| DC Chemicals | DC22518 | Exenatide >98% | 5mg | $128 | 2021-12-16 | Buy |
| DC Chemicals | DC22518 | Exenatide >98% | 25mg | $348 | 2021-12-16 | Buy |
| Sigma-Aldrich | E7144 | Exendin 4 ≥97% | 0.1mg | $334 | 2026-03-19 | Buy |
| Sigma-Aldrich | E7144 | Exendin 4 ≥97% | 500μg | $988 | 2026-03-19 | Buy |
| Sigma-Aldrich | 1269105 | Exenatide United States Pharmacopeia (USP) Reference Standard | 2.73mg | $2050 | 2026-03-19 | Buy |
| Tocris | 1933 | Exendin 4 | 1 | $393 | 2021-12-16 | Buy |
| Usbiological | E9050-02 | Exendin 4 | 1mg | $672 | 2021-12-16 | Buy |
Properties
RTECS :VT9545000
storage temp. :−20°C
solubility :≥145 mg/mL in DMSO; insoluble in EtOH; ≥52 mg/mL in H2O with gentle warming
form :White to off-white solid.
color :White to off-white
Water Solubility :Soluble in water (1 mg/ml)
Sequence :His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :HTQBXNHDCUEHJF-AAPNSGCPNA-N
storage temp. :−20°C
solubility :≥145 mg/mL in DMSO; insoluble in EtOH; ≥52 mg/mL in H2O with gentle warming
form :White to off-white solid.
color :White to off-white
Water Solubility :Soluble in water (1 mg/ml)
Sequence :His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :HTQBXNHDCUEHJF-AAPNSGCPNA-N
Safety Information
| Symbol(GHS): |
|
|||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | |||||||||||||||||||||
| Hazard statements: |
|
|||||||||||||||||||||
| Precautionary statements: |
|
Description
Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. The dosing regimen for exenatide is 5 or 10 mg twice daily, administered as a subcutaneous injection within an hour before morning and evening meals. Following subcutaneous administration, peak plasma concentrations of exenatide are reached in 2.1 h, and the plasma pharmacokinetic profile is dose proportional. The most common adverse events reported with exenatide include nausea, vomiting, diarrhea, feeling jittery, dizziness, headache, and dyspepsia.More related product prices
Liraglutide Vildagliptin Rosiglitazone Repaglinide Metformin TOLBUTAMIDE Stanozolol Triptorelin Somatostatin ElcatoninRelated product price
- Liraglutide
$70-1991.25 - Vildagliptin
$5-2766.23 - Rosiglitazone
$12-970
Suppliers and manufacturers
BOC Sciences
Linyi Changqing Chemical Co., LTD
Chengdu Shengnuo Biopharm Co.,Ltd
Adachibio Inc.
Henan Tianfu Chemical Co.,Ltd.




