Product Categories
| Country: | China |
|---|---|
| Tel: | 21-21-61263452 |
| Mobile: | +8613641803416 |
| E-mail: | ymbetter@glbiochem.com |
| QQ: | 3346126642 |
| Skype: | Chat Now! |
| Company Name: | Shanghai GL Peptide Ltd |
| Tel: | 86-21-61263385 |
| Fax: | 86-21-61263399 |
| Email: | ymbetter@glbiochem |
| WebSite: | http://www.glbiochem.com |
| Nationality: | CHINA |
| Product Name | MF | CAS | Details |
|---|
| D-P | C2Cl4O2 | 503-38-8 | Details |
| H-D-Phe-Phe-Arg-chloromethylketone | C25H33ClN6O3 | 74392-49-7 | Details |
| D-PHE-PRO-ARG-CMK | C21H31ClN6O3 | 65149-23-7 | Details |
| D-PHE-PRO-ARG-PARANITROANILIDE | C26H34N8O5 | Details |
| H-D-Pro-Phe-Arg-chloromethylketone | C21H31ClN6O3 | 88546-74-1 | Details |
| H-D-Tyr-Pro-Arg-chloromethylketone | C21H31ClN6O4 | 98833-79-5 | Details |
| DVal-Leu-Arg-pNA | C23H38N8O5 | Details |
| H-D-Val-Leu-Lys-chloromethylketone | C18H35ClN4O3 | 75590-15-7 | Details |
| DYKDDDDK;DYKDDDDK | C41H60N10O20 | Details |
| Dynorphin: 2-17, amide, porcine | C90H147N31O20 | Details |
| Dynorphin (Neo-Endorphin) and Related Peptides | Details |
| Dynorphin A (1-17);YGGFLRRIRPKLKWDNQ | C99H155N31O23 | 80448-90-4 | Details |
| Dynorphin A (1-10), porcine;YGGFLRRIRP | C57H91N19O12 | 79994-24-4 | Details |
| Dynorphin A (1-10), amide, porcine | C57H92N20O11 | 79985-49-2 | Details |
| Dynorphin A (1-10)-Gly-chloromethylketone | C60H95ClN20O12 | Details |
| Dynorphin A (1-11) amide | C63H104N22O12 | 79985-48-1 | Details |
| Dynorphin A (1-13)-Gly-NH(CH2)5NH2, [Arg11&13]- | Details |
| [Leu5]-Enkephalin;YGGFL | C28H37N5O7 | 58822-25-6 | Details |
| Dynorphin A: 1-6, porcine | C34H49N9O8 | 75106-70-6 | Details |
| Dynorphin A (1-7), porcine;YGGFLRR | C40H61N13O9 | 77101-32-7 | Details |
| Dynorphin A (1-8), porcine;YGGFLRRI | C46H72N14O10 | 75790-53-3 | Details |
| Dynorphin A (1-9), porcine;YGGFLRRIR | C52H84N18O11 | 77259-54-2 | Details |
| Dynorphin A (2-13), porcine;GGFLRRIRPKLK | C66H117N23O13 | Details |
| Dynorphin A: 2-12, porcine | C60H105N21O12 | Details |
| Dynorphin A: 2-17, porcine | C90H146N30O21 | Details |
| Dynorphin A: 3-13, porcine | C64H114N22O12 | Details |
| Dynorphin A: 3-17, porcine | C88H143N29O20 | Details |
| Dynorphin A: 3-8, porcine | C35H60N12O7 | Details |
| Dynorphin A: 6-17, porcine | C71H120N26O17 | Details |
| Dynorphin A: 7-17, porcine | C65H108N22O16 | Details |
| Dynorphin A: 9-17, porcine | C53H85N17O14 | Details |
| Rimorphin | C74H115N21O17 | 85006-82-2 | Details |
| H-D-Tyr-Val-Gly-OH | C16H23N3O5 | 86030-52-6 | Details |
| Ecdysis-Triggering Hormone (Manduca sexta) | C127H206N36O38S3 | Details |
| Echistatin | C217H341N71O74S9 | 129038-42-2 | Details |
| EGF Receptor 661-681 [KRELVEPLTPSGEAPNQALLR-NH2];KRELVEPLTPSGEAPNQALLR-NH2 | C101H172N30O32 | Details |
| Epidermal Growth Factor Receptor Peptide (985-996) | C61H93N13O23 | 96249-43-3 | Details |
| EGFR (988-993), Amide, Phosphorylated;DADE-pY-L-NH2 | C31H46N7O16P | Details |
| DNP-PRO-LEU-GLY-ILE-ALA-GLY-ARG-NH2 | C36H57N13O11 | Details |
| 360 MMP FRET Substrate I;Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 | C45H64N14O11 | 121282-17-5 | Details |
| Dnp-Pro-TNF-α (71-82) amide (human) | Details |
| Dnp-Pro-β-cyclohexyl-Ala-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 | Details |
| Dnp-Pro-β-cyclohexyl-Ala-Gly-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 | Details |
| Doc-6 (130-145)??;GVQREQNERFNVYLMP | Details |
| Dok-4 (130-145)??;GVQCEQTDRFNVFLLP | Details |
| Dolastatin 15 | C45H68N6O9 | 123884-00-4 | Details |
| DOTA-[Tyr3]-Octreotide Acid (Octreotate);DOTA-fCYwKTCT(Disulfidebridge:2-7) | C65H92N14O19S2 | Details |
| Eisenin | C13H20N4O6 | Details |
| ELDKWA | C35H52N8O11 | Details |
| EMP-1 (Epithelial Membrane Protein) | Details |
| Endokinin A/B??;GKASQFFGLM-NH2 | Details |
| EGF Receptor Substrate 1 | Details |
| EGF Receptor Substrate 2 | C54H81N13O21 | Details |
| Egg Laying Hormone (Aplysia california) | Details |
| Eglin c (42-45)-methyl ester · HCl | C21H38N4O6 | 133463-25-9 | Details |
| Eglin c: 60-63 Methyl ester | C19H35N5O7 | 131696-94-1 | Details |
| Fibronectin CS-1 Fragment (1978-1982) | C26H45N5O10 | Details |
| E-I-L-E-V-P-S-T | C39H66N8O15 | Details |
| Endotoxin Substrate | C25H40N8O7 | Details |
| T20;Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 | C13H20N2O2S | 74038-65-6 | Details |
| Enkephalin Amide, [Leu5]- | Details |
| Enkephalin Amide, [Met5]- | Details |
| Enkephalin and Related Peptides | Details |
| Enkephalin, [D-Ala2,Leu5,Arg6]- | Details |
| Enkephalin, [Leu5]- | Details |
| Enkephalinase Substrate | C28H38N6O5 | Details |
| Enkephalins | C26H33I2N5O6 | 103213-42-9 | Details |
| ent-[Amyloid β-Protein (20-16)]-β-Ala-D-Lys(ent-[Amyloid β-Protein (16-20)]) | C79H119N15O13 | Details |
| ent-Amyloid b-Protein (1-42) | Details |
| Entero-Hylambatin | C63H91N17O18S2 | 198541-90-1 | Details |
| Entero-Kassinin | C58H89N15O21S | Details |
| Enterostatin (bovine, canine, porcine) | Details |
| Enterostatin (human, mouse, rat) | Details |
| Enterostatin, human | C21H36N8O6 | 117830-79-2 | Details |
| Enterostatins | Details |
| Enterotoxin STp (E. coli) | C81H110N20O26S6 | 115474-04-9 | Details |
| H-Ala-Gly-Ser-Glu-OH | C13H22N4O8 | 61756-28-3 | Details |
| Eotaxin (human) | Details |
| Ep-CAM (263-271);GLKAGVIAV | C38H70N10O10 | Details |
| Endomorphins and Related Peptides | Details |
| Endonuclease Antigenic Site | C108H167N27O29 | Details |
| β-Endorphin, human;YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE | C77H120N18O26S | 59004-96-5 | Details |
| β-Endorphin, porcine;YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ | Details |
| Endorphins, Lipotropins, Pro-Opiomelanocortin Fragments and Related Peptides | Details |
| Endostatin (52-114)-NH2 (JKC362) | Details |
| Endothelial-Monocyte-Activating Polypeptide II-Derived Peptide | C81H142N26O22 | 155029-52-0 | Details |
| Endothelin (8-21), N-Succinyl-[Glu9, Ala11&15]- | Details |
| Endothelin 1, human, porcine;CSCSSLMDKECVYFCHLDIIW(Disulfidebridge:1-15and3-11) | C109H159N25O32S5 | 117399-94-7 | Details |
| Endothelin-2, human | C115H160N26O32S4 | 123562-20-9 | Details |
| Endothelin-3, human | C121H168N26O33S4 | 117399-93-6 | Details |
| IRL-1038 | C68H92N14O15S2 | 144602-02-8 | Details |
| Endothelin-1: 1-15, amide, human | C70H109N17O23S5 | Details |
| Endothelin-1: 1-15, human | C70H108N16O24S5 | Details |
| Endothelins and Related Peptides | Details |
| Esculentin-1A | Details |
| Ethoxycarbonyl-Met-Leu-Phe-OMe | C24H37N3O6S | Details |
| Ephrin-A2-Selective YSA-Peptide | C59H86N12O20S2 | Details |
| Epiamastatin · HCl | C21H39ClN4O8 | 100992-59-4 | Details |
| Erktide??;IPTTPITTTYFFFK | C58H93N19O16 | Details |
| Erythropoietin Mimetic Peptide Sequence 20 | C72H99N17O17S2 | Details |
| Product Total: Product Page: | ||||
| 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 | ||||