Product Categories
| Country: | China |
|---|---|
| Tel: | 21-61263452 |
| Mobile: | 13641803416 |
| E-mail: | |
| QQ: | |
| Skype: | Chat Now! |
| Company Name: | Shanghai GL Peptide Ltd |
| Tel: | 86-21-61263385 |
| Fax: | 86-21-61263399 |
| Email: | ymbetter@glbiochem |
| WebSite: | http://www.glbiochem.com |
| Nationality: | CHINA |
| Product Name | MF | CAS | Details |
|---|
| FSH Receptor-Binding Inhibitor Fragment (BI-10) | C42H67N13O19 | 163973-98-6 | Details |
| Galanin (1-13)-Substance P (5-11), amide, Galantide;GWTLNSAGYLLGPQQFFGLM-NH2 | C104H151N25O26S | 138579-66-5 | Details |
| FR139317 | C33H44N6O5 | 142375-60-8 | Details |
| Ghrelin-Cys(BMCC-biotinyl) (human) | Details |
| Gastrin-1, human, sulfated (Gastrin II);Pyr-GPWLEEEEEA-Y(SO3H)-GWMDF-NH2 | C97H124N20O34S2 | 19361-51-4 | Details |
| Gap26 Scrambled | Details |
| Ghrelin, human, biotinyl | Details |
| Glp-Trp-OH | Details |
| G-dR-G-D-S-P-A-S-S-K | C37H64N14O16 | Details |
| Ghrelin, human;GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR | C149H249N47O42 | 258279-04-8 | Details |
| Galanin-Like Peptide (porcine) | Details |
| g-Bag Cell Factor | Details |
| Ghrelin, rat, [Des-Gln14], biotinyl | Details |
| Gastrin Releasing Peptide, porcine;APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 | C126H198N38O31S2 | 74815-57-9 | Details |
| Glucagon-Like Peptide 1 (7-36), amide, human;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | C149H226N40O45 | 107444-51-9 | Details |
| N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys | C43H65N7O9 | 71901-21-8 | Details |
| Galanin (1-16), porcine, rat;GWTLNSAGYLLGPHAI | C78H116N20O21 | 125118-77-6 | Details |
| Galanin (1-13)-Neuropeptide Y (25-36), amide, M32;GWTLNSAGYLLGPRHYINLITRQRY-NH2 | C136H209N41O34 | 147138-51-0 | Details |
| Galanin-Like Peptide (rat) | C288H461N87O83S | 245114-97-0 | Details |
| H-Glu-Ala-Gly-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-Tyr-Thr-Trp-Thr-Gly-Ala-OH | C81H119N19O30S2 | 191529-67-6 | Details |
| Galacto-RGD | C34H52N10O12 | 922175-70-0 | Details |
| Gap27 Cx40 Scrambled | Details |
| Gastrin and Related Peptides | Details |
| Glp-Trp-OEt | Details |
| Gly-Amyloid β-Protein (15-25)-Gly-ε-aminocaproyl(-Lys)6 | Details |
| GIP (1-30), porcine, amide;YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2 | C162H245N41O47S | 134846-93-8 | Details |
| Gastric Juice Peptide Fragmentc | C57H91N15O21 | Details |
| Galanin-Like Peptide (human) | C292H451N83O84S | 245114-99-2 | Details |
| G Protein Antagonist | C57H64N12O9S | 143675-79-0 | Details |
| For-Phe-Met-OH | C15H20N2O4S | 60461-13-4 | Details |
| Glucagon (19-29), bovine, human, porcine;AQDFVQWLMNT | C61H89N15O18S | 64790-15-4 | Details |
| Glt-Ala-Ala-Pro-Leu-pNA.H2O | C28H40N6O9 | Details |
| Galanin, porcine;GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 | C146H213N43O40 | 88813-36-9 | Details |
| Glycoprotein IIb Fragment (296-306) | C47H75N17O20 | Details |
| Galanin (1-13)-Bradykinin (2-9), amide, M35;GWTLNSAGYLLGPPPGFSPFR-NH2 | C107H153N27O26 | 142846-71-7 | Details |
| Gap27 Cx37,43 | Details |
| Gastric Inhibitory Polypeptide (GIP) and Related Peptides | Details |
| GLP-1(7-36) Amide | Details |
| Glucagon (1-29), bovine, human, porcine, [Des-His1,Des-Phe6,Glu9]- | Details |
| GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) | 1802089-53-7 | Details |
| Glu-Gly-Arg-chloromethylketone | C14H26ClN7O4 | Details |
| GIP, human;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | C226H338N60O66S | 100040-31-1 | Details |
| Galanin Message Associated Peptide, GMAP (1-41), amide;ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 | C206H326N56O64S1 | 132699-74-2 | Details |
| Gluten Exorphin A5 | C29H37N5O9 | Details |
| G-dR-G-D-S-P | C22H37N9O10 | Details |
| Glycoprotein IIb Fragment (300-312) | C57H94N18O18 | 155114-45-7 | Details |
| Glp-His-Pro-Gly-NH2 | C18H25N7O5 | Details |
| Galanin (1-13)-Pro-Pro-(Ala-Leu)2-Ala, amide;GWTLNSAGYLLGPPPALALA-NH2 | C94H145N23O24 | 143896-17-7 | Details |
| Gap18 | Details |
| Ghrelin (mouse, rat) | Details |
| Ghrelin, rat, [Des-octanoyl] | Details |
| Galanin (1-13)-Mastoparan | C133H222N34O32 | 177352-81-7 | Details |
| For-Nle-Leu-Phe-OH | C22H33N3O5 | Details |
| Gastrin-1, human;Pyr-GPWLEEEEEAYGWMDF-NH2 | C97H124N20O31S | 10047-33-3 | Details |
| Galanin, human;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS | C139H210N42O43 | 119418-04-1 | Details |
| Glycoprotein Hormone a (32-46) amide | C78H128N24O20S | Details |
| Gastric Inhibitory Polypeptide (3-42) (human) | Details |
| Gastrin Releasing Peptide (GRP) and Related Peptides | Details |
| Ghrelin, rat, [Des-Gln14, Des-octanoyl] | Details |
| GLY-ARG-MNA | Details |
| Glu-pNA.H2O | C11H15N3O6 | Details |
| Galanin, rat;GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 | C141H211N43O41 | 114547-31-8 | Details |
| Glu(EDANS)-ADAM 8 (165-172)-Lys(DABCYL) amide (human) | C79H113N23O16S | Details |
| For-Val-Val-OH | C11H20N2O4 | 210347-62-9 | Details |
| Gap27 Cx37,43 Scrambled | Details |
| Gastric Inhibitory Polypeptide (GIP), human | Details |
| Glp-Leu-Asn-Phe-Ser-Ala-Gly-Trp-NH2: Glp-LNFSAGW-NH2 | Details |
| Glucagon and Related Peptides | Details |
| H-Gly-Arg-Gly-Asp-OH | C14H25N7O7 | 97461-81-9 | Details |
| Galanin-Lys(Biotin), human;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin) | Details |
| Gap20 | Details |
| Ghrelin, human, [Des-octanoyl] | Details |
| Ghrelin, rat, biotinyl | Details |
| Glucagon-Like Peptide II, human | C171H266N48O56S1 | 99120-49-7 | Details |
| G-F-R | C17H26N6O4 | 121822-47-7 | Details |
| Galanin Message Associated Peptide, GMAP (16-41), amide;LQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 | C134H219N35O37S | 129541-35-1 | Details |
| GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat) | C140H214N36O43 | 161748-29-4 | Details |
| Galnon | C40H46N4O6 | 475115-35-6 | Details |
| GRGDTP;GRGDTP | C23H39N9O10 | 108682-58-2 | Details |
| H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH | C50H82N10O14 | 188818-21-5 | Details |
| Galanin and Related Peptides | Details |
| Gastrin Releasing Peptide (GRP), human | Details |
| Ghrelin, rat, [Des-Gln14] | Details |
| Gastric Inhibitory Peptide, porcine | 59392-49-3 | Details |
| Galanin Message Associated Peptide, GMAP (25-41), amide;TIMEFLAFLHLKEAGAL-NH2 | C90H143N21O22S | 132567-21-6 | Details |
| H-Gly-Ala-Tyr-OH | C14H19N3O5 | 92327-84-9 | Details |
| Gastric Inhibitory Polypeptide (6-30) amide (human) | C139H209N35O38S | 1139691-72-7 | Details |
| Glu20-salmon calcitonin | C145H239N43O49S2 | Details |
| GLY-ARG-CMK | C9H18ClN5O2 | Details |
| H-Glu-Ala-Leu-Phe-Gln-pNA | C34H46N8O10 | 198551-00-7 | Details |
| Ginseng Tetrapeptide | C18H33N7O7 | 178553-95-2 | Details |
| GRP (14-27) (human, porcine, canine) | C75H110N24O16S2 | Details |
| Gap27 Cx40 | Details |
| Gastrin (5-17), [Leu15]- | Details |
| Glp-Leu-Asn-Phe-Ser-Thr-Gly-Trp-NH2: Glp-LNFSTGW-NH2 | Details |
| Glucagon-Like Peptide (GLP) and Related Peptides | Details |
| Gap26 | C70H107N19O19S | 197250-15-0 | Details |
| Glucagon (1-29), bovine, human, porcine;HSQGTFTSDYSKYLDSRRAQDFVQWLMNT | C153H225N43O50S | 75217-63-9 | Details |
| Galanin (1-19) (human) | C89H130N26O25 | 136005-51-1 | Details |
| Product Total： Product Page： | ||||
| 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 | ||||