ChemicalBook
Chinese english Germany Japanese Korea

CHARYBDOTOXIN Produkt Beschreibung

CHARYBDOTOXIN Struktur
95751-30-7
CAS-Nr.
95751-30-7
Englisch Name:
CHARYBDOTOXIN
Synonyma:
CHTX;RCHTX;CHARYBDOTOXIN;RCHARYBDOTOXIN;Charybdotoxin ChTX;PubChem ID: 56842037;CHARYBDOTOXIN, RECOMBINANT;M.W. 4295.89 C176H277N57O55S7;CHARYBDOTOXIN, RECOMBINANT, E COLI;PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
CBNumber:
CB1249060
Summenformel:
C176H277N57O55S7
Molgewicht:
4295.89
MOL-Datei:
Mol file

CHARYBDOTOXIN Eigenschaften

RTECS-Nr.
FL7535000
storage temp. 
−20°C
Aggregatzustand
lyophilized powder

Sicherheit

WGK Germany  3

CHARYBDOTOXIN Chemische Eigenschaften,Einsatz,Produktion Methoden

Verwenden

Biochemical probe.

CHARYBDOTOXIN Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


CHARYBDOTOXIN Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 44)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Hubei xin bonus chemical co. LTD
86-13657291602
027-59338440 sales@guangaobio.com CHINA 23049 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
J & K SCIENTIFIC LTD. 400-666-7788 +86-10-82848833
86-10-82849933 jkinfo@jkchemical.com;market6@jkchemical.com China 96815 76
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Ascent Scientific 4401179829988
4402030 700 369 customerservice@ascentscientific.co.uk United Kingdom 279 60
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky (shanghai) International Co.,Ltd 021-50135380
shchemsky@sina.com China 15426 60
Shanghai LiuShi Pharmaceutical Technology Co., Ltd. 021-60135539
021-38721356 shlschemical@hotmail.com China 9915 55
Sigma-Aldrich 021-61415566 800-819-3336(Tel) 400-620-3333(Mobile)
orderCN@merckgroup.com China 34131 80

95751-30-7()Verwandte Suche:


  • CHARYBDOTOXIN
  • CHARYBDOTOXIN, RECOMBINANT
  • CHARYBDOTOXIN, RECOMBINANT, E COLI
  • CHARYBDOTOXIN, LEIURUS QUINQUESTRIATUS HEBRAEUS
  • CHTX
  • PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
  • PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (DISULFIDE BRIDGE: 7-28,13-33 AND 17-35)
  • PYR-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLN-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER-OH
  • PYR-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER
  • PYR-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER-OH
  • PYR-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER-OH (DISULFIDE BRIDGE: 7-28, 13-33 AND 17-35)
  • PGLU-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER [DISULFIDE BRIDGES: 7-28, 13-33, 17-35]
  • RCHTX
  • RCHARYBDOTOXIN
  • CHARYBDOTOXIN (CHTX) SYNTHETIC >98% 37 A MINO ACID PEPTIDE
  • CHARYBDOTOXIN (LEIURUS QUINQUESTRIATUS VAR. HEBRAEUS)
  • M.W. 4295.89 C176H277N57O55S7
  • Charybdotoxin ChTX
  • Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridges:Cys7-Cys28, Cys13-Cys33, Cys17-C
  • Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
  • PubChem ID: 56842037
  • 95751-30-7
  • C176H277N57O55S7
  • BioChemical
  • Cell Biology
  • Cell Signaling and Neuroscience
  • Voltage-gated Ion Channels
  • Monovalent Ion Channels
  • Potassium Channel Modulators
  • Ion Channels
  • Potassium Channel ModulatorsCell Signaling and Neuroscience
  • Potassium Channel ModulatorsPeptides for Cell Biology
  • Ion Channel Modulating Peptides
  • Monovalent Ion Channels
  • Scorpion
  • Toxins and Venoms
  • Voltage-gated Ion Channels
  • Potassium channel
  • Ion Channels
  • peptide
Copyright 2019 © ChemicalBook. All rights reserved