ChemicalBook
Chinese english Germany Japanese Korea

H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 Produkt Beschreibung

H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 Struktur
123583-37-9
CAS-Nr.
123583-37-9
Englisch Name:
H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
Synonyma:
PYY3-36' HUMAN;PYY (HUMAN, 3-36);PEPTIDE YY (3-36);PYY (3-36) (HUMAN);PEPTIDE YY (HUMAN);3-36-Human peptide YY;Human peptide YY (3-36);PEPTIDE YY (HUMAN, 3-36);PEPTIDE YY FRAGMENT 3-36;PEPTIDE YY (3-36) (HUMAN)
CBNumber:
CB3665826
Summenformel:
C180H278N53O54R
Molgewicht:
4048.45602
MOL-Datei:
123583-37-9.mol

H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 Eigenschaften

storage temp. 
−20°C
Aggregatzustand
lyophilized powder

Sicherheit

WGK Germany  3

H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 Chemische Eigenschaften,Einsatz,Produktion Methoden

H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 45)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28236 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
ApexBio Technology LLC +1-832-696-8203
+1-832-641-3177 info@apexbt.com United States 477 60
ChangZhou Chemfarmer Foreign Trade Co.,Ltd +86-(0)519-89886667 18516062846
+86-(0)519-89886667 sales@chemfarmer.com China 339 58
Creative Peptides
info@creative-peptides.com United States 6249 56
Shanghai EFE Biological Technology Co., Ltd. 021-65675885
021-65675885 info@efebio.com China 9933 58

123583-37-9()Verwandte Suche:


  • M.W. 4049.46 C180H279N53O54
  • 3-36-Human peptide YY
  • Human peptide YY (3-36)
  • Peptide YY protein fragment 3-36 (human)
  • H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
  • Peptide YY Fragment 3-36 human|Peptide YY(3-36), PYY, human
  • H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
  • H-IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
  • H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • H-ALA-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-SER-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • H2N-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • PYY (HUMAN, 3-36)
  • PYY (3-36) (DOG, MOUSE, PORCINE, RAT)
  • PYY (3-36) (HUMAN)
  • PYY3-36' HUMAN
  • PEPTIDE YY (HUMAN, 3-36)
  • PEPTIDE YY (3-36) [PYY3-36] (HUMAN)
  • PEPTIDE YY(3-36) PYY HUMAN
  • PEPTIDE YY FRAGMENT 3-36
  • PEPTIDE YY (HUMAN)
  • PEPTIDE YY (3-36)
  • PEPTIDE YY (3-36) (DOG, MOUSE, PORCINE, RAT)
  • PEPTIDE YY (3-36) (HUMAN)
  • 123583-37-9
  • C180H279N53O54
  • C176H272N52O54
  • Peptide
  • Neuropeptide Y (NPY ) receptor
  • Obesity
  • proteins
Copyright 2019 © ChemicalBook. All rights reserved