ChemicalBook
Chinese english Germany Japanese Korea

PEPTIDE YY, HUMAN Produkt Beschreibung

PEPTIDE YY, HUMAN Struktur
118997-30-1
CAS-Nr.
118997-30-1
Englisch Name:
PEPTIDE YY, HUMAN
Synonyma:
PYY (HUMAN);Human peptide YY;PEPTIDE YY, HUMAN;PEPTIDE YY PYY HUMAN;PubChem ID: 126455957;Peptide YY (human) Acetate;M.W. 4309.75 C194H295N55O57;PEPTIDE TYROSINE TYROSINE, HUMAN;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;Peptide YY (human)|Peptide YY, PYY, human
CBNumber:
CB5758746
Summenformel:
C194H295N55O57
Molgewicht:
4309.7524
MOL-Datei:
118997-30-1.mol

PEPTIDE YY, HUMAN Eigenschaften

storage temp. 
−20°C

Sicherheit

WGK Germany  3

PEPTIDE YY, HUMAN Chemische Eigenschaften,Einsatz,Produktion Methoden

PEPTIDE YY, HUMAN Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


PEPTIDE YY, HUMAN Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 47)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50
Hunan Hui Bai Shi Biotechnology Co., Ltd. 0731-85526065
0731-85526065 3002778010@qq.com China 2930 62
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
Shanghai Aladdin Bio-Chem Technology Co.,LTD 021-20337333/400-620-6333
021-50323701 sale@aladdin-e.com China 24986 65
ChangZhou Chemfarmer Foreign Trade Co.,Ltd +86-(0)519-89886667 18516062846
+86-(0)519-89886667 sales@chemfarmer.com China 339 58
Chengdu HuaXia Chemical Reagent Co. Ltd 400-1166-196 18981987031
028-84555506 QQ:800101999 cdhxsj@163.com China 9978 58
Shanghai Macklin Biochemical Co.,Ltd. 15221275939
021-50706099 shenlinxing@macklin.cn China 15719 55

118997-30-1()Verwandte Suche:


  • H-TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • PEPTIDE YY PYY HUMAN
  • PEPTIDE TYROSINE TYROSINE, HUMAN
  • PEPTIDE YY, HUMAN
  • PYY (HUMAN)
  • TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
  • YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
  • PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
  • M.W. 4309.75 C194H295N55O57
  • Human peptide YY
  • H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
  • Peptide YY (human) Acetate
  • Peptide YY (human)|Peptide YY, PYY, human
  • PubChem ID: 126455957
  • 118997-30-1
  • 6161204-22-9
  • C194H295N55O57
  • Amino Acids and Peptides
  • Biochemicals and Reagents
  • BioChemical
  • Y Receptor Ligands
  • Obesity Peptides
  • Peptides
  • Peptide
  • Neuropeptide Y (NPY ) receptor
  • -
Copyright 2019 © ChemicalBook. All rights reserved