ChemicalBook
Chinese english Germany Japanese Korea

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Produkt Beschreibung

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Struktur
127317-03-7
CAS-Nr.
127317-03-7
Englisch Name:
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
Synonyma:
M-PACAP;PACAP-27;PACAP 1-27;PACAP (1-27) AMIDE;PACAP 27 AMIDE, OVINE;powdered posterior pitultary;PACAP-27 (HUMAN, OVINE, RAT);HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2;PACAP (1-27), HUMAN, OVINE, RAT;PACAP (1-27) (HUMAN, SHEEP, RAT)
CBNumber:
CB7101106
Summenformel:
C142H224N40O39S
Molgewicht:
3147.61
MOL-Datei:
127317-03-7.mol

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Eigenschaften

Dichte
1.45±0.1 g/cm3(Predicted)
storage temp. 
−20°C
Aggregatzustand
solid
Farbe
white

Sicherheit

WGK Germany  3

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Chemische Eigenschaften,Einsatz,Produktion Methoden

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 59)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 linda@hubeijusheng.com CHINA 28234 58
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4001 58
Beijing Yibai Biotechnology Co., Ltd
0086-182-6772-3597
sales03@yibaibiotech.com CHINA 420 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
career henan chemical co
0086-371-86658258
0086-371-86658258 factory@coreychem.com CHINA 29643 58
Zhuozhou Wenxi import and Export Co., Ltd
+8613111626072
+8613111626072 zzwenxi@126.com CHINA 7497 58
Neostar United (Changzhou) Industrial Co., Ltd.
+0086-519-85557386
+0086-519-85557389 marketing1@neostarunited.com CHINA 4111 58
3B Pharmachem (Wuhan) International Co.,Ltd. 18930552037 821-50328103-801
86-21-50328109 3bsc@sina.com China 15880 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202-
+86-21-64545202 info@hanhonggroup.com;info@hanhonggroup.com China 43258 64

127317-03-7()Verwandte Suche:


  • HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
  • HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
  • H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
  • [ARG14,20,21, LEU16] PACAP (1-27), HUMAN, OVINE, RAT
  • [ARG14,20,21, LEU16] PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-27), HUMAN, OVINE, RAT
  • ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-27 OVINE
  • ADENYLATE CYCLASE ACTIVATING PEPTIDE-27
  • pituitary adenylate cyclase activating*polypeptid
  • pituitary adenylate cyclase activating polypeptide-27 ovine
  • H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
  • powdered posterior pitultary
  • HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-ARG-GLN-LEU-ALA-VAL-ARG-ARG-TYR-LEU-ALA-ALA-VAL-LEU-NH2
  • HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
  • HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
  • PACAP-38 (1-27) aMide (huMan, Mouse, ovine, porcine, rat), Pituitary Adenylate Cyclase Activating Polypeptide-27 (huMan, Mouse, ovine, porcine, rat)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 27 AMIDE, OVINE
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-27 (HUMAN, MOUSE, OVINE, PORCINE, RAT)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE
  • PITUITARY ADENYLATE CYCLASE-ACTIVATING POLYPEPTIDE 1-27
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-27) AMIDE (HUMAN, OVINE, RAT)
  • PITUARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 27 (HUMAN, 1-27 AMIDE) OVINE, RAT
  • PITUITARY ADENYLATE CYCLASE-ACTIVATING PEPTIDE (1-27)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-27), HUMAN, OVINE, RAT
  • PACAP-27
  • PACAP-38 (1-27) AMIDE (HUMAN, MOUSE, OVINE, PORCINE, RAT)
  • PACAP 27 AMIDE, OVINE
  • PACAP27 (HUMAN, 1-27 AMIDE) (OVINE, RAT)
  • PACAP-27 (HUMAN, MOUSE, OVINE, PORCINE, RAT)
  • PACAP-27 (HUMAN, OVINE, RAT)
  • PACAP 1-27
  • PACAP (1-27) AMIDE
  • PACAP (1-27), AMIDE, HUMAN, OVINE, RAT
  • PACAP (1-27), HUMAN, OVINE, RAT
  • PACAP (1-27) (HUMAN, SHEEP, RAT)
  • PACAP-PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (HUMAN, OVINE, RAT)
  • M-PACAP
  • PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem
  • 127317-03-7
  • C142H224N40O39S
  • C43H66O12N12S2
  • Cell Biology
  • Cell Signaling and Neuroscience
  • BioChemical
  • Adenylyl Cyclase Activators
  • Cyclic Nucleotide Metabolism
  • G Proteins and Cyclic Nucleotides
  • Peptide
  • VIP and PACAP receptor
Copyright 2019 © ChemicalBook. All rights reserved