ChemicalBook
Chinese Japanese Germany

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
CAS No.
133514-43-9
Chemical Name:
ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
Synonyms
EXENDIN (9-39);EXENDIN 3 (9-39);EXENDIN (9-39) AMIDE;EXENDIN FRAGMENT 9-39;EXENDIN [9-39] PEPTIDE;EXENDIN-3 (9-39) AMIDE;Exendin (9-39) Acetate;Exendin 4 (9-39) amide;Exendin FragMent 9-39Exendin;M.W. 3369.79 C149H234N40O47S
CBNumber:
CB0109941
Molecular Formula:
C149H234N40O47S
Formula Weight:
3369.76
MOL File:
133514-43-9.mol

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Properties

Density 
1.51
RTECS 
LF2460000
storage temp. 
−20°C
Water Solubility 
Soluble in water at 1mg/ml

SAFETY

WGK Germany  3

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 price More Price(5)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich E7269 Exendin Fragment 9-39 ≥95% (HPLC) 133514-43-9 .1mg $296 2018-11-13 Buy
Alfa Aesar J66126 Exendin (9-39) 133514-43-9 0.5mg $232 2018-11-13 Buy
Alfa Aesar J66126 Exendin (9-39) 133514-43-9 1mg $367 2018-11-13 Buy
Cayman Chemical 19890 Exendin-3 (9-39) amide ≥95% 133514-43-9 500μg $199 2018-11-19 Buy
Cayman Chemical 19890 Exendin-3 (9-39) amide ≥95% 133514-43-9 1mg $338 2018-11-19 Buy

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Chemical Properties,Uses,Production

Uses

Biological probe.

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Preparation Products And Raw materials

Raw materials

Preparation Products


ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Suppliers

Global( 54)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
GenicBio Limited
+86-21-37621270
+86-21-67621877 service@genicbio.com CHINA 995 58
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15926 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Nanjing Chemlin Chemical Co., Ltd 025-83697070
+86-25-83453306 sales@chemlin.com.cn China 19998 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-54291107 info@hanhonggroup.com China 43389 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32492 50
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 996 55
Shanghai LiuShi Pharmaceutical Technology Co., Ltd. 021-60135539
021-38721356 shlschemical@hotmail.com China 9947 55
Shanghai Aladdin Bio-Chem Technology Co.,LTD 021-20337333/400-620-6333
021-50323701 sale@aladdin-e.com China 25106 65
MedChemexpress LLC 609-228-6898
609-228-5909 sales@medchemexpress.com United States 4618 58

View Lastest Price from ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 manufacturers

Image Release date Product Price Min. Order Purity Supply Ability Manufacturer
2018-07-29 Exendin (9-39)
133514-43-9
US $1.00 / MG 5MG >95% 5mg,10mg,25mg,100mg,1g,10g GenicBio Limited

133514-43-9(ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2)Related Search:


  • ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
  • H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
  • EXENDIN 3 (9-39)
  • EXENDIN (9-39)
  • EXENDIN (9-39) AMIDE
  • EXENDIN [9-39] PEPTIDE
  • EXENDIN FRAGMENT 9-39
  • DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
  • EXENDIN-3 (9-39) AMIDE
  • M.W. 3369.79 C149H234N40O47S
  • Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
  • 9-39-Exendin 3(Heloderma horridum)
  • H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
  • Exendin FragMent 9-39Exendin
  • H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
  • 9-39-Exendin 3(Heloderma horridum) (9CI)
  • Exendin (9-39) Acetate
  • Exendin 4 (9-39) amide
  • C149H234N40O47S
  • C149H234N40O47S1
  • 133514-43-9
  • Hormones
  • Obesity Research
  • Exendin
  • Cytokines, Growth Factors and Hormones
  • Peptide
  • GLP-1 Receptor LigandsObesity Research
  • Cytokines Growth Factors and Hormones (Obesity)
  • ExendinPeptides for Cell Biology
  • Hormones
  • Obesity Peptides
  • Obesity Research
  • Other Obesity Research Products
  • Glucagon receptor and related
  • BioChemical
  • Cell Biology
  • Cell Signaling and Neuroscience
Copyright 2017 © ChemicalBook. All rights reserved