Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> Sermorelin

Sermorelin

Sermorelin price.
  • $134.65 - $2800
  • Product name: Sermorelin
  • CAS: 86168-78-7
  • MF: C149H246N44O42S
  • MW: 3357.89
  • EINECS:1312995-182-4
  • MDL Number:MFCD00076559
  • Synonyms:SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
13 prices
Selected condition:
Brand
  • American Custom Chemicals Corporation
  • Biosynth
  • DC Chemicals
  • Sigma-Aldrich
  • Thermo Scientific Chemicals
Package
  • 500ug
  • 0.5MG
  • 1000ug
  • 1mg
  • 2000ug
  • 5000ug
  • 10000ug
  • 100mg
  • 250mg
  • 1g
  • 0.5 mg
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberSHG0000180
  • Product descriptionSERMORELIN 95.00%
  • Packaging0.5MG
  • Price$600.6
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109068
  • Product descriptionGRF (1-29) amide (human) acetate salt
  • Packaging10000ug
  • Price$2800
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109068
  • Product descriptionGRF (1-29) amide (human) acetate salt
  • Packaging5000ug
  • Price$1650
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109068
  • Product descriptionGRF (1-29) amide (human) acetate salt
  • Packaging500ug
  • Price$270
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109068
  • Product descriptionGRF (1-29) amide (human) acetate salt
  • Packaging1000ug
  • Price$470
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFG109068
  • Product descriptionGRF (1-29) amide (human) acetate salt
  • Packaging2000ug
  • Price$820
  • Updated2026-06-04
  • Buy
  • ManufacturerDC Chemicals
  • Product numberDC10321
  • Product descriptionSermorelin >98%
  • Packaging250mg
  • Price$1100
  • Updated2026-05-24
  • Buy
  • ManufacturerDC Chemicals
  • Product numberDC10321
  • Product descriptionSermorelin >98%
  • Packaging100mg
  • Price$550
  • Updated2026-05-24
  • Buy
  • ManufacturerDC Chemicals
  • Product numberDC10321
  • Product descriptionSermorelin >98%
  • Packaging1g
  • Price$2200
  • Updated2026-05-24
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberG6771
  • Product descriptionGrowth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC)
  • Packaging1mg
  • Price$814
  • Updated2026-04-30
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ61111
  • Product descriptionGrowth Hormone Releasing Factor (GRF) (1-29) amide, human
  • Packaging0.5 mg
  • Price$134.65
  • Updated2025-07-31
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ61111
  • Product descriptionGrowth Hormone Releasing Factor (GRF) (1-29) amide, human
  • Packaging0.5mg
  • Price$144
  • Updated2023-06-20
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ61111
  • Product descriptionGrowth Hormone Releasing Factor (GRF) (1-29) amide, human
  • Packaging1mg
  • Price$204
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
American Custom Chemicals Corporation SHG0000180 SERMORELIN 95.00% 0.5MG $600.6 2021-12-16 Buy
Biosynth FG109068 GRF (1-29) amide (human) acetate salt 10000ug $2800 2026-06-04 Buy
Biosynth FG109068 GRF (1-29) amide (human) acetate salt 5000ug $1650 2026-06-04 Buy
Biosynth FG109068 GRF (1-29) amide (human) acetate salt 500ug $270 2026-06-04 Buy
Biosynth FG109068 GRF (1-29) amide (human) acetate salt 1000ug $470 2026-06-04 Buy
Biosynth FG109068 GRF (1-29) amide (human) acetate salt 2000ug $820 2026-06-04 Buy
DC Chemicals DC10321 Sermorelin >98% 250mg $1100 2026-05-24 Buy
DC Chemicals DC10321 Sermorelin >98% 100mg $550 2026-05-24 Buy
DC Chemicals DC10321 Sermorelin >98% 1g $2200 2026-05-24 Buy
Sigma-Aldrich G6771 Growth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC) 1mg $814 2026-04-30 Buy
Thermo Scientific Chemicals J61111 Growth Hormone Releasing Factor (GRF) (1-29) amide, human 0.5 mg $134.65 2025-07-31 Buy
Thermo Scientific Chemicals J61111 Growth Hormone Releasing Factor (GRF) (1-29) amide, human 0.5mg $144 2023-06-20 Buy
Thermo Scientific Chemicals J61111 Growth Hormone Releasing Factor (GRF) (1-29) amide, human 1mg $204 2021-12-16 Buy

Properties

Melting point :>189°C (dec.)
alpha :D20 -63.1° (c = 1 in 30% acetic acid)
Density :1.45±0.1 g/cm3(Predicted)
storage temp. :−20°C
solubility :Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly)
form :Solid
color :White to Off-White
Stability :Hygroscopic
InChIKey :BVLCEKWPOSAKSZ-YQMCHIOTSA-N
CAS DataBase Reference :86168-78-7(CAS DataBase Reference)

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

A peptide hormone that stimulates release of the growth hormone

Related product price