Sermorelin
|
- $134.65 - $2800
- Product name: Sermorelin
- CAS: 86168-78-7
- MF: C149H246N44O42S
- MW: 3357.89
- EINECS:1312995-182-4
- MDL Number:MFCD00076559
- Synonyms:SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
13 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- Biosynth
- DC Chemicals
- Sigma-Aldrich
- Thermo Scientific Chemicals
Package
- 500ug
- 0.5MG
- 1mg
- 1000ug
- 2000ug
- 5000ug
- 10000ug
- 100mg
- 250mg
- 1g
- 0.5 mg
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberSHG0000180
- Product descriptionSERMORELIN 95.00%
- Packaging0.5MG
- Price$600.6
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFG109068
- Product descriptionGRF (1-29) amide (human) acetate salt
- Packaging2000ug
- Price$820
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFG109068
- Product descriptionGRF (1-29) amide (human) acetate salt
- Packaging500ug
- Price$270
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFG109068
- Product descriptionGRF (1-29) amide (human) acetate salt
- Packaging1000ug
- Price$470
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFG109068
- Product descriptionGRF (1-29) amide (human) acetate salt
- Packaging5000ug
- Price$1650
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFG109068
- Product descriptionGRF (1-29) amide (human) acetate salt
- Packaging10000ug
- Price$2800
- Updated2026-06-04
- Buy
- ManufacturerDC Chemicals
- Product numberDC10321
- Product descriptionSermorelin >98%
- Packaging1g
- Price$2200
- Updated2026-05-24
- Buy
- ManufacturerDC Chemicals
- Product numberDC10321
- Product descriptionSermorelin >98%
- Packaging100mg
- Price$550
- Updated2026-05-24
- Buy
- ManufacturerDC Chemicals
- Product numberDC10321
- Product descriptionSermorelin >98%
- Packaging250mg
- Price$1100
- Updated2026-05-24
- Buy
- ManufacturerSigma-Aldrich
- Product numberG6771
- Product descriptionGrowth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC)
- Packaging1mg
- Price$814
- Updated2026-04-30
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ61111
- Product descriptionGrowth Hormone Releasing Factor (GRF) (1-29) amide, human
- Packaging0.5 mg
- Price$134.65
- Updated2025-07-31
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ61111
- Product descriptionGrowth Hormone Releasing Factor (GRF) (1-29) amide, human
- Packaging0.5mg
- Price$144
- Updated2023-06-20
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ61111
- Product descriptionGrowth Hormone Releasing Factor (GRF) (1-29) amide, human
- Packaging1mg
- Price$204
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| American Custom Chemicals Corporation | SHG0000180 | SERMORELIN 95.00% | 0.5MG | $600.6 | 2021-12-16 | Buy |
| Biosynth | FG109068 | GRF (1-29) amide (human) acetate salt | 2000ug | $820 | 2026-06-04 | Buy |
| Biosynth | FG109068 | GRF (1-29) amide (human) acetate salt | 500ug | $270 | 2026-06-04 | Buy |
| Biosynth | FG109068 | GRF (1-29) amide (human) acetate salt | 1000ug | $470 | 2026-06-04 | Buy |
| Biosynth | FG109068 | GRF (1-29) amide (human) acetate salt | 5000ug | $1650 | 2026-06-04 | Buy |
| Biosynth | FG109068 | GRF (1-29) amide (human) acetate salt | 10000ug | $2800 | 2026-06-04 | Buy |
| DC Chemicals | DC10321 | Sermorelin >98% | 1g | $2200 | 2026-05-24 | Buy |
| DC Chemicals | DC10321 | Sermorelin >98% | 100mg | $550 | 2026-05-24 | Buy |
| DC Chemicals | DC10321 | Sermorelin >98% | 250mg | $1100 | 2026-05-24 | Buy |
| Sigma-Aldrich | G6771 | Growth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC) | 1mg | $814 | 2026-04-30 | Buy |
| Thermo Scientific Chemicals | J61111 | Growth Hormone Releasing Factor (GRF) (1-29) amide, human | 0.5 mg | $134.65 | 2025-07-31 | Buy |
| Thermo Scientific Chemicals | J61111 | Growth Hormone Releasing Factor (GRF) (1-29) amide, human | 0.5mg | $144 | 2023-06-20 | Buy |
| Thermo Scientific Chemicals | J61111 | Growth Hormone Releasing Factor (GRF) (1-29) amide, human | 1mg | $204 | 2021-12-16 | Buy |
Properties
Melting point :>189°C (dec.)
alpha :D20 -63.1° (c = 1 in 30% acetic acid)
Density :1.45±0.1 g/cm3(Predicted)
storage temp. :−20°C
solubility :Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly)
form :Solid
color :White to Off-White
Stability :Hygroscopic
InChIKey :BVLCEKWPOSAKSZ-YQMCHIOTSA-N
CAS DataBase Reference :86168-78-7(CAS DataBase Reference)
alpha :D20 -63.1° (c = 1 in 30% acetic acid)
Density :1.45±0.1 g/cm3(Predicted)
storage temp. :−20°C
solubility :Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly)
form :Solid
color :White to Off-White
Stability :Hygroscopic
InChIKey :BVLCEKWPOSAKSZ-YQMCHIOTSA-N
CAS DataBase Reference :86168-78-7(CAS DataBase Reference)
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
A peptide hormone that stimulates release of the growth hormoneMore related product prices
Leuprorelin Eptifibatide 106612-94-6 Pramlintide acetate Triptorelin acetate Thymopentin Nesiritide acetate Calcitonin salmon Elcatonin Taltirelin SermorelinRelated product price
-
Leuprorelin
$55-1775 -
Eptifibatide
$14-1600 -
106612-94-6
$133-2262.7
Suppliers and manufacturers
C N C H E M U N I O N C O . , L T D .
Cellmano Biotech Limited
Fuan Bio
Hefei Synth Biotechnology Co. LTD
Hunan Chenxi Lanpeptide Biotechnology Co., Ltd.
Hefei novabio-chem Biotechnology Co., Ltd.
Changsha Weixi Biotechnology Co., Ltd.
Shanghai Boyle Chemical Co., Ltd.
ChemFuture PharmaTech (Jiangsu) Ltd
LGM Pharma




