StructureChemical NameCASMF
AC-ALA-SER-ALA-GLY-ALA-SER-ALA-GLY-LEU-ALA-GLY-GLN-GLY-ALA C45H75N15O19
AC-ALA-ALA-PRO-ALA-PNA 96699-74-0 C22H30N6O7
AC-ALA-ALA-ALA-ALA-OME 30802-29-0 C15H26N4O6
AAVALLPAVLLALLAKNNLKECGLY C126H217N31O32S
AAVALLPAVLLALLAKNNLKDCGLF C125H215N31O31S
Ac-B-Ala-OH
AAVALLPAVLLALLAP
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
AAVALLPAVLLALLAK
a-Calcitonin Gene Related Peptide, chicken
abl-bcr fusion protein
a-Calcitonin Gene Related Peptide, human C163H267N51O49S2
ABL2B Fusion Protein(SH3)
AC-AKPFD-AMIDE C29H43N7O8
ablastin
acaloleptin A
acamelin 74161-27-6 C10H8O4
AC326-alpha
AC-ALPHA-BENZYL-4,6-O-BENZYLIDENE-MURAMIC ACID 19229-57-3 C25H29NO8
A23187, Ca-Mg
ABL2B, Recombinant, Human
A.CANDIDUS
ACBC-OH 1-aMinocyclobutane-1-carboxylic acid
AcalyphaIndicaDryLeaf
Acalyptophis neurotoxin
Acamprosate Ca
AcbC protein
ACAMPROSATE CALCIUM REFERENCE SPECTRUM EPY(CRM STANDARD)
Acamprosate-d12 Calcium Trihydrate C10H14D12N2O11S2?Ca
ACAMPROSATE IMPURITY A3-AMINOPROPANE-1-SULPHONIC ACID EPY(CRM STANDARD)
Acamprosate calcium 77337-73-6 C10H20CaN2O8S2
Acamprosate-D3 Calcium Salt
Acamprosate-d3 Calcium C5H7NO4SD3 . 0.5Ca
Acamprosate-d6 Calcium Trihydrate C5H10NO4S-
Acanjaposide A C47H72O19
Acanjaposide B C47H72O18
Acanjaposide C C47H74O18
7-MAC 56610-72-1 C24H24N6O4S2
Acankoreoside C C55H90O22
Acankoreoside D C49H78O18
Acankoreoside A
AC-AO(C12)AEAAEKAAKYAAEAAEKAAKAO(C12)A-NH2 C131H224N32O37
ABL CYTOSOLIC SUBSTRATE C64H101N15O16
Acan125 protein
AcbD protein
Acantrifoic acid A 654663-85-1 C32H48O7
Acanthopanax P.E.
acanthifolicin methyl ester 78111-16-7 C45H70O13S
Acanthophyllum compound 2
Acanthophis antarcticus b
acanthodiolglycoside
Acanthopanax gracilistylus, extract
acanthifolicin 77739-71-0 C44H68O13S
acanthoxin
Acanthopanax senticosus P.E
AcanthopanaxExtract
ACANTHOPANAXROOTEXTRACTPOWDER
acanthoidine C16H26N4O2
acanthoic acid
Acantholide C19H24O6
Acanthifoline C10H12N2O
Acanthospermolide 75744-64-8 C20H26O6
Acanthoside C34H46O18
Acanthoside D C34H46O18
Acanthoglabrolide C23H30O7
Acanthospermal A 56689-33-9 C23H30O8
Acanthoine C16H22N4O2
Acanthamolide 64852-96-6 C19H25O5
ACANTHAMOEBA
ACANTHOPANAXGRACILISTYLUS
acanthin
Acanthophyllum compound 1
Acanthophis antarcticus toxin Aa c 80940-61-0 C280H464N92O90S10
acanthophin D 126601-49-8
AC133 antigen
AC anti-fungus leather finishing agent
Acanthothamine 107651-98-9 C34H43NO16
Acanthothamine hydrate methanol
Ac, b-Endorphin: 1-27, camel, bovine, ovine
ABLE protocol
ABLE(R) K COMPETENT CELLS
ABLE(R) K E COLI STRAIN
ABLE(R) C ELECTROPORATION-COMP CELLS
ABLE(R) C COMPETENT CELLS
ABLE(R) C E COLI STRAIN
ABLE(R) K ELECTROPORATION-COMP CELLS
ABLE(R)C AND K E COLI STRAINS
(A-caPhos)2 PdCl2 (CH3)2NC6H4P(C6H11)2PdCl2P(C6H4N(CH3)2)(C6H11)2
AC-BETA-ALA-OME 31295-20-2 C6H11NO3
AC-BETA-(2-THIENYL)-ALA-OH 83396-76-3 C9H11NO3S
AC-BETA-(3-PYRIDYL)-ALA-OET HCL C11H15ClN2O3
AC-BETA-ENDORPHIN, BOVINE, CAMEL, OVINE
AC-BETA-ALA-OH 3025-95-4 C5H9NO3
Acaprazine 55485-20-6 C15H21Cl2N3O
Aca2 protein
Aca1 protein
ACARAGEL(TM)
ABL1 Fusion Protein (SH2)
ABL2 Fusion Protein (SH3)
ABL1 Fusion Protein(SH3)
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128