StructureChemical NameCASMF
AC-DL-PHE(3-CN)-OH 367272-51-3 C12H12N2O3
AC-DL-PHE(4-IPR)-OET C16H23NO3
AC-DL-PHE(4-CN)-OET 173963-92-3 C14H16N2O3
AC-DL-PHE-BETA-NAPHTHYL ESTER 20874-31-1 C21H19NO3
AC-DL-PHE-PNA 19746-42-0 C17H17N3O4
AC-DL-PHE(3,4,5-OME)-OET C16H23NO6
AC-DL-PRO-OH 1074-79-9 C7H11NO3
AC-CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Acebrophylline
Acebrochol 514-50-1 C29H48Br2O2
Acebropniiinc
ACE CHROMATOGRAPHY SPRAYER, 75ML ERLEN-M EYER FLASK W/#15 ACE-THRED & AIR T
Ace chromatography column
Acebrophylline 179118-73-1 C22H28Br2N6O5
Acebutolol DiMer IMpurity 1330165-98-4 C33H47N3O8
Acebutolol hydrochloride USP
AC-D-2-NAL-4-CHLORO-D-PHE-BETA-(3-PYRIDYL)-D-ALA-GLY-ARG-PRO-D-ALA-NH2 292141-31-2 C48H59ClN12O8
Ace Buchner funnel with hose connection and 24/40 joint
(-)-Acebutolol 68107-82-4
AC-D-2-NAL-P-CHLORO-D-PHE-BETA-(3-PYRIDYL)-D-ALA-SER-ARG-D-GLU-LEU-ARG-PRO-D-ALA-NH2
ACEBUTOLOL HCL USP(CRM STANDARD)
Acebutolol-D5 1189500-68-2 C18H28N2O4
Acebutolol 37517-30-9 C18H28N2O4
AC-D-NAL-D-CPA-D-PAL C32H31CLN4O5
acedapsone 77-46-3 C16H16N2O4S
ACEBUTOLOL IMPURITY IN-[3-ACETYL-4-[(2RS)-3-(ETHYLAMINO)-2-HYDROXYPROPOXY]PHENYL)BUTANAMIDE EPY(CRM STANDARD)
ACEBUTOLOL IMPURITY CN-(3-ACETYL-4-HYDROXYPHENYL)BUTANAMIDE EPY(CRM STANDARD)
AC-D-2-NAL-D-4-CLPHE-D-3-PAL 129225-22-5 C32H31ClN4O5
Acebutolol hydrochloride 34381-68-5 C18H29ClN2O4
Ace bubble meter solution
Ace Buchner funnel
AC-D-NAL-D-CPA-D-TRP-SER-TYR-D-LYS(DHP)-LEU-LYS(DHP)-PRO-D-ALA-NH2 C83H107ClN14O15
acebutolol azide 80186-92-1 C14H20N4O3
AceburicAcid
Aceclofenac iMpurity F (20Mg)
Aceclofenac Methyl Ester 139272-66-5 C17H15Cl2NO4
Aceclofenac Benzyl Ester 100499-89-6 C23H19Cl2NO4
Aceclofenac Ethyl Ester 139272-67-6 C18H17Cl2NO4
Aceclofenac for peak identification
ACECLIDINE C9H15NO2
AceclofenacBp
Aceclofenac,Airtal
ACECLIDINE HYDROCHLORIDE 6109-70-2 C9H16ClNO2
Aceclofenac 89796-99-6 C16H13Cl2NO4
Aceclofenac
Aceclofenac,Anti-Inflammatory&Analgesics
Ace Claisen adapter
Aceclidine, Q-OAc
ACE, CMO-BSA
AC-D-LYS-OH 58840-79-2 C8H16N2O3
ACE CONDENSER ADAPTER FOR SIZE C &
AC-D-LYS-PRO-D-VAL-NH2 C18H32N4O5
acecobarb 52453-04-0 C18H21NO3.C12H12N2O3.C10H13NO2.C9H8O4.C8H10N4O2.H3O4P
Ace coiled condenser
AC-DMQD-CHO 259199-63-8 C20H31N5O10S
acediasulfone sodium 127-60-6 C14H14N2O4S.Na
Ace dilatometer, A.O.C.S.
Ace dilatometer, volumetric
ACE diagnostic kit
2,3,4,4a,5,6,7,11b-octahydro-1H-benzo[6,7]cyclohepta[1,2-b]pyridine
1,2,3,4,4a,5,6,10b-octahydrobenzo[h]quinoline
1,2,3,6,7,8,8aβ,8bα-Octahydrobiphenylene
6,7,9,10,10a,10b,11,12-Octahydrobenzo[f]cyclopenta[a]quinolizine-6,7,7a,8,9,10(8H)-hexacarboxylic acid hexamethyl ester 49616-76-4
2,3,3a,4,5,7,8,10b-Octahydro-10-hydroxy-3a,6-dimethyl-3-oxo-1H-cyclopenta[7,8]naphtho[2,3-b]furan-7-carboxylic acid methyl ester 40625-49-8
1,2,3,4,4aβ,5,6,10bα-Octahydro-4-propylbenzo[f]quinoline
2,3,3aα,4,5,6,9,9bα-Octahydro-4-methyl-3-methylene-4β-vinylnaphtho[1,2-b]furan-6,9-dione
1,2,3,4,4a,5,6,14b-Octahydrodibenz[a,j]anthracene 35281-16-4
2,3,7,8,9,10,10a,10b-Octahydro-1H-pyrrolo[1',2':3,4]imidazo[1,5-a]pyridine 54966-11-9
AC-DNLD-CHO 775289-20-8 C20H31N5O10
AC-D-NLE-OH 54896-21-8 C8H15NO3
2'-Ac-Docetaxel 151509-27-2 C45H55NO15
Ace double-jacketed coiled condenser
Ace double-arc PTFE stirrer blade
Ace double-jacketed coiled condenser with Ace-ThredTM hose connections
Ac-D-Norleu-OH
Ac-D-Norval-OH
ABOD protocol
Ace dry ice condenser-trap
AC-DP
AC-CYIQNCPLG-AMIDE C45H70N12O13S2
AC-D-NVA-OH 57357-56-9 C7H13NO3
ACE Elevated Control
Ac-D-Nva-L-Glu-OH
Ac-E-E-M-Q-R-R-NH2
ACE - Enzime convertied angiotensina
ACE2 enzyme
Ace enlarging adapter
AC-EE(PS)EERDDHLLPM-OH C67H105N18O31PS
AC-D-PHE(4-CL)-OH C11H12ClNO3
ABNORMAL SERUM CONTROL
ABNORMAL REFERENCE PLASMA-2
AC-D-PHE-TYR-OH 73942-36-6 C20H22N2O5
ABNORMAL REFERENCE PLASMA-1
abnormal spindle protein
abnormal wing disc protein 129311-56-4
ABNORMAL REFERENCE PLASMA-1 FOR PROTHROMBIN TIME(CRM STANDARD)
AC-D-PHE(3-CN)-OH C12H12N2O3
ABNORMAL HEMOSTASIS REFERENCE PLASMA
ABNORMAL REFERENCE PLASMA-2 FOR PROTHROMBIN TIME(CRM STANDARD)
Abnormal Reference Plasma-1 (for Prothrombin Time)
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134