StructureChemical NameCASMF
ACCONON CA-40 PEG-40 CASTOR OIL POLYOXYETHYLENE CASTOR OIL
ACCONON E POLYOXYPROPYLENE 15 STEARYL ETHER PPG-15 STEARYL ETHER
ACCONON CC-6 POLYOXYETHYLENE 6 CAPRYLIC/ CAPRIC GLYCERIDES PEG-6 CAPRYLIC/CAPRIC GLYCERIDES
ACCONON CO-7 POLYOXYETHYLENE 7 COCONUT GLYCERIDES PEG-7 GLYCERYL COCOATE
ACCONON CO-7 PEG-7 COCONUT GLYCERIDES PEG-7 GLYCERYL COCOATE
ACCONON W230 CETEARETH-20
ACCONON SORB-20 PEG-20 SORBITOL SORBETH-20
ACCONON CC-6 PEG-6 CAPRYLIC/ CAPRIC GLYCERIDES
ACCONON CC-6, EP PEG-6 CAPRYLIC/ CAPRIC GLYCERIDES MACROGOL 6 GLYCEROL CAPRYLOCAPRATE
A:B-Neolupane 52768-76-0 C30H52
A:B-Neooleanane 91219-71-5 C30H52
ACCOQUAT OMS-5 PEG-5 OLEYLAMINE METHOSULFATE PEG-5 OLEAMMONIUM METHOSULFATE
AC-DFGPLVG-AMIDE C35H52N8O10
ACCORD
AC-DESDFGPLVGADS-AMIDE C57H84N14O24
ACCOUNTANTS
ACCOUNTANT
AC-DEVD-CHO 184179-08-6 C20H30N4O11
AC-DEVD-PNA 189950-66-1 C26H34N6O13
AC-DEVD-AMC 169332-61-0 C30H37N5O13
AC-DEVD-AFC 201608-14-2 C30H34F3N5O13
AC-DEVD-CHO 169332-60-9 C20H30N4O11
Ac-DEVD-pN
AC-CRATKML-NH2 C35H66N12O9S2
ACCRAASSAY HUMAN IGG SUBCLASS RID KIT POLYCLONAL (4 X 17 WELLS)
AC-D-GLU(OSU)-OBZL C18H20N2O7
Ac-D-Glu(OtBu)-OH C11H19NO5
Accreditation fees
AC-32 DIANHYDRIDE
Ethyl 2-(acetylamino)-3-[3,5-diamino-4-(4-methoxyphenoxy)phenyl]propanoate 440667-78-7 C20H25N3O5
4a,6c-Diazacyclobuta[a]cyclopenta[cd]pentalene (9CI) 83721-67-9 C10H8N2
AC-3-(2,6-DICHLORO-BZL)-TYR-ILE-ASN-LEU-ILE-D-THR-ARG-GLN-ARG-TYR-NH2 140842-17-7 C70H105Cl2N19O16
Ac-2,3-DidehydroPhe-L-Phe-OH
Ac-2,3-DidehydroPhe-L-Ala-OMe
Ac-2,3-DidehydroPhe-D-Leu-OH
Ac-2,3-DidehydroPhe-L-Ala-OH
Ac-D-Homoleu-OH
AC 010220 (dihydrochloride) 1132827-21-4 C29H34Cl2N6O4S
12a,13c-Dihydro-11-methyl-4,6-dibromo-2-tert-butyl-1,3,7,8,12a,13c-hexaaza-13H-benzo[de]naphthacene-13-imine
3a,13c-Dihydro-2-methoxychryseno[5,6-d]-1,3-dioxole 77508-62-4 C20H16O3
1aβ,11cβ-Dihydro-1H-chryseno[5,6-b]azirine
7a,14c-Dihydronaphtho[2,1-b]naphtho[1',2':4,5]furo[3,2-d]furan
1aα,11cα-Dihydrochryseno[5,6-b]oxirene
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(2-THIENYL)METHANONE 317833-17-3 C19H15NO3S
3a,11c-dihydro-3H-benzo[5,6]chromeno[4,3-c]isoxazol-1(4H)-yl(5-methyl-3-phenyl-4-isoxazolyl)methanone
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOLE-1(4H)-CARBOXAMIDE 477853-76-2 C15H14N2O3
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-(4-BENZHYDRYLPIPERAZINO)-1-ETHANONE 477853-79-5 C33H33N3O3
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-[(4-CHLOROPHENYL)SULFANYL]-1-ETHANONE 477853-78-4 C22H18ClNO3S
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-1-ETHANONE C16H15NO3
2-(2-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-OXOETHOXY)-1H-ISOINDOLE-1,3(2H)-DIONE 477853-80-8 C24H18N2O6
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(5-METHYL-3-PHENYL-4-ISOXAZOLYL)METHANONE 317833-21-9 C25H20N2O4
1-[3a,11c-dihydro-3H-benzo[5,6]chromeno[4,3-c]isoxazol-1(4H)-yl]-2-(4-benzhydrylpiperazino)-1-ethanone
1-[3a,11c-dihydro-3H-benzo[5,6]chromeno[4,3-c]isoxazol-1(4H)-yl]-2-[(4-chlorophenyl)sulfanyl]-1-ethanone
3a,11c-dihydro-3H-benzo[5,6]chromeno[4,3-c]isoxazol-1(4H)-yl[3-(2-chloro-6-fluorophenyl)-5-methyl-4-isoxazolyl]methanone
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-PIPERIDINO-1-ETHANONE 317833-29-7 C21H24N2O3
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL[3-(2-CHLORO-6-FLUOROPHENYL)-5-METHYL-4-ISOXAZOLYL]METHANONE 317833-20-8 C25H18ClFN2O4
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(PHENYL)METHANONE 317833-15-1 C21H17NO3
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(4-CHLOROPHENYL)METHANONE 477853-75-1 C21H16ClNO3
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(1-ADAMANTYL)METHANONE 339098-61-2 C25H27NO3
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-CHLORO-1-ETHANONE 477853-77-3 C16H14ClNO3
2-{2-[3a,11c-dihydro-3H-benzo[5,6]chromeno[4,3-c]isoxazol-1(4H)-yl]-2-oxoethoxy}-1H-isoindole-1,3(2H)-dione
1-[3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL]-2-MORPHOLINO-1-ETHANONE 317833-28-6 C20H22N2O4
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOL-1(4H)-YL(3,4-DICHLOROPHENYL)METHANONE 317833-18-4 C21H15Cl2NO3
3A,11C-DIHYDRO-3H-BENZO[5,6]CHROMENO[4,3-C]ISOXAZOLE-1(4H)-CARBOTHIOAMIDE 317377-62-1 C15H14N2O2S
Ethyl 2-(acetylamino)-3-[3,5-diiodo-4-(4-methoxyphenoxy)phenyl]propanoate 83249-56-3 C20H21I2NO5
AC-DIISALVTSTFIIEKQPPQVLK-AMIDE C115H193N27O33
Ac-D-Ile-OH
AC-DIMRVNVDKVLERDQKLSELDDRADALQAGASQFESAAKLKRKYWWKNLK-OH C261H422N76O79S
AC-3,5-DINITRO-TYR-OET 29358-99-4 C13H15N3O8
ACD/Index Name Pro
ACEA 273734-07-9 C22H36ClNO
ACEA 1011 153504-72-4 C9H4ClF3N2O2
ACCU3 ASSEMBLY
ACD/IUPAC NAME GENERATOR
ACCUANGLE PROTRACTOR
ACD/IUPAC Name Pro
ACCUBOND
ACE( ACE, testis-specific isoform precursor)
accucast 131656-13-8
Ace addition funnel
Accudenz A.G., Cell Separation Media
AC-CTPYDINQM-AMIDE C47H72N12O16S2
ACCUFLUOR NFTH-AL2O3 BLEND 162241-33-0 C6H13B2F9N2O
ACCUGENE 10X PBS
ACCUGENE NEUTRALIZE SOLN
ACCUGENE WATER, MOLBIO
ACCUGENE 1M TRIS-HCL BUFFER (PH 7.2)
ACCUGENE 10X TAE BUFFER
ACCUGENE 10X TRIS-GLYCINE
ACCUGENE 0.5M EDTA
ACCUGENE 0.5M EDTA SOLUTION
ACCUGENE 3M NA ACETATE
ACCUGENE 5X TBE BUFFER
ACCUGENE DENATURING SOLN
ACCUGENE 10X TRIS-GLY SDS
ACCUGENE 20X SSPE
ACCUGENE 10X HS BUFFER
ACCUGENE 10% SDS
ACCUGENE 1M TRIS-HCL BUFFER (PH 8.0)
ACCUGENE 20X SSC
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132